Methanoculleus bourgensis MAB1: MMAB1_1700 Help Entry MMAB1_1700        CDS       T04314                                  Symbol porD Name (GenBank) Pyruvate synthase subunit porD   KO K00171   pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1] Organism mema  Methanoculleus bourgensis MAB1 Pathway mema00010   Glycolysis / Gluconeogenesis mema00020   Citrate cycle (TCA cycle) mema00620   Pyruvate metabolism mema00633   Nitrotoluene degradation mema00640   Propanoate metabolism mema00650   Butanoate metabolism mema00680   Methane metabolism mema00720   Other carbon fixation pathways mema01100   Metabolic pathways mema01110   Biosynthesis of secondary metabolites mema01120   Microbial metabolism in diverse environments mema01200   Carbon metabolism mema01210   2-Oxocarboxylic acid metabolism Module mema_M00307   Pyruvate oxidation, pyruvate => acetyl-CoA mema_M00620   Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate Brite KEGG Orthology (KO) [BR:mema00001]  09100 Metabolism   09101 Carbohydrate metabolism    00010 Glycolysis / Gluconeogenesis     MMAB1_1700 (porD)    00020 Citrate cycle (TCA cycle)     MMAB1_1700 (porD)    00620 Pyruvate metabolism     MMAB1_1700 (porD)    00640 Propanoate metabolism     MMAB1_1700 (porD)    00650 Butanoate metabolism     MMAB1_1700 (porD)   09102 Energy metabolism    00720 Other carbon fixation pathways     MMAB1_1700 (porD)    00680 Methane metabolism     MMAB1_1700 (porD)   09111 Xenobiotics biodegradation and metabolism    00633 Nitrotoluene degradation     MMAB1_1700 (porD) Enzymes [BR:mema01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.1  pyruvate synthase      MMAB1_1700 (porD) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_6 Fer4_7 Fer4_2 Fer4_10 Fer4_21 Fer4_9 Fer4_16 Fer4_8 Fer4_17 Fer4_4 Fer4_15 Fer4_22 Fer4_3 Fer4_13 GATA Fer4_18 Motif Other DBs NCBI-ProteinID:  CVK32913 UniProt:  A0A0X3BLN7 LinkDB All DBs Position 1:1371028..1371273 Genome browser AA seq 81 aa AA seqDB search MRERLALSRPTEASSGKTGSWRTFRPVVDREVCNACGLCAQYCPDGVIDEELNIDLDYCK GCGICANECPKEAITMVREER NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgagagagagacttgcgctcagcagacccacggaggcctcgtcagggaagacagggtcg tggcggacgttccggcccgtcgtggacagggaggtctgcaacgcctgcgggctctgcgcc cagtactgcccggacggggtcatcgacgaggaactcaatatcgaccttgattactgcaag ggctgcggtatctgcgcaaacgagtgcccgaaggaagccatcactatggttcgggaggaa cgctga

DBGET integrated database retrieval system