Methanoculleus bourgensis MAB1: MMAB1_1816 Help Entry MMAB1_1816        CDS       T04314                                  Name (GenBank) protein of unknown function   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism mema  Methanoculleus bourgensis MAB1 Pathway mema03010   Ribosome Brite KEGG Orthology (KO) [BR:mema00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     MMAB1_1816   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     MMAB1_1816  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:mema03011]     MMAB1_1816    04121 Ubiquitin system [BR:mema04121]     MMAB1_1816   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mema04147]     MMAB1_1816 Ribosome [BR:mema03011]  Ribosomal proteins   Eukaryotes    Small subunit     MMAB1_1816   Archaea     MMAB1_1816 Ubiquitin system [BR:mema04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    MMAB1_1816 Exosome [BR:mema04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    MMAB1_1816   Exosomal proteins of colorectal cancer cells    MMAB1_1816 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 MqsA_antitoxin Motif Other DBs NCBI-ProteinID:  CVK33029 UniProt:  A0A0X3BM89 LinkDB All DBs Position 1:complement(1451107..1451265) Genome browser AA seq 52 aa AA seqDB search MAVKRHECYEVKGDKVALQKRHCPRCGPGVLMAEHKDRVPAASAATPSSGSK NT seq 159 nt NT seq  +upstreamnt  +downstreamnt atggcagtcaagagacacgagtgctacgaggtcaagggcgataaggtagccctgcagaag cggcactgcccccggtgcggccccggcgtgctgatggccgagcacaaggaccgggtgcct gcggcaagtgcggctacaccgagttccggaagtaagtag

DBGET integrated database retrieval system