Metallosphaera sedula MJ1HA: MJ1HA_0288 Help Entry MJ1HA_0288        CDS       T08286                                  Name (GenBank) 50S ribosomal protein L40e   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism memj  Metallosphaera sedula MJ1HA Pathway memj03010   Ribosome Brite KEGG Orthology (KO) [BR:memj00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     MJ1HA_0288   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     MJ1HA_0288  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:memj03011]     MJ1HA_0288    04121 Ubiquitin system [BR:memj04121]     MJ1HA_0288 Ribosome [BR:memj03011]  Ribosomal proteins   Eukaryotes    Large subunit     MJ1HA_0288   Archaea     MJ1HA_0288 Ubiquitin system [BR:memj04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    MJ1HA_0288 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_L40e zf-ChsH2 HypA Zn_ribbon_3 DZR HVO_2753_ZBP Zn_Ribbon_1 DnaJ_CXXCXGXG Zn_ribbon_HMPTM DUF7577 Zn_ribbon_tTFIIB Zn_ribbon_LapB Zn_ribbon_13 Zn_ribbon_8 Motif Other DBs NCBI-ProteinID:  BBL46190 LinkDB All DBs Position complement(198440..198610) Genome browser AA seq 56 aa AA seqDB search MPLTDQAKIQIVQERVFIKKVCRNCGALNSIRATKCRRCHSTNLRPKKKELPTKRA NT seq 171 nt NT seq  +upstreamnt  +downstreamnt atgcctttaacagatcaggcaaaaattcagatagtccaagagagagtgtttataaagaag gtgtgcagaaactgcggtgcccttaactcgatcagggctacaaaatgcagaagatgtcat agtacaaatctcagaccaaagaagaaggagttgccaactaagagagcttga

DBGET integrated database retrieval system