Methanoplanus endosymbiosus: L6E24_03320 Help Entry L6E24_03320       CDS       T08358                                  Name (GenBank) 30S ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism mend  Methanoplanus endosymbiosus Pathway mend03010   Ribosome Brite KEGG Orthology (KO) [BR:mend00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     L6E24_03320   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     L6E24_03320  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:mend03011]     L6E24_03320    04121 Ubiquitin system [BR:mend04121]     L6E24_03320   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mend04147]     L6E24_03320 Ribosome [BR:mend03011]  Ribosomal proteins   Eukaryotes    Small subunit     L6E24_03320   Archaea     L6E24_03320 Ubiquitin system [BR:mend04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    L6E24_03320 Exosome [BR:mend04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    L6E24_03320   Exosomal proteins of colorectal cancer cells    L6E24_03320 SSDB OrthologParalogGFIT Motif Pfam:  Ribosomal_S27 Ribosomal_L37e Lar_restr_allev Zn_ribbon_RPAB4 IBR Phage_gp86 IBR_1 Rcat_RNF216 Zn_ribbon_3 Zn_ribbon_13 Cas12f1-like_TNB Zn_ribbon_IS1595 Zn_ribbon_ACC DUF8260 HVO_0416 DUF1451 MqsA_antitoxin Zn_ribbon_Nudix DUF7571 RUBY_RBDX Zn_ribbon_LysW McsA zf-C2H2_ZN142 Motif Other DBs NCBI-ProteinID:  UUX93165 UniProt:  A0A9E7TKZ3 LinkDB All DBs Position complement(811616..811768) Genome browser AA seq 50 aa AA seqDB search MVSRYKYYNVEGDKAEVQKKNCPRCGAGVYMAQHKDRVSCGKCGYTEFNN NT seq 153 nt NT seq  +upstreamnt  +downstreamnt atggtgagccgctacaagtattacaatgttgagggcgacaaggcagaagtgcagaagaag aactgcccacgctgcggagccggagtctatatggctcagcataaagatcgtgtctcctgc ggtaagtgcgggtacactgaattcaacaactaa

DBGET integrated database retrieval system