Methanoplanus endosymbiosus: L6E24_08515 Help Entry L6E24_08515       CDS       T08358                                  Name (GenBank) 4Fe-4S binding protein   KO K00171   pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1] Organism mend  Methanoplanus endosymbiosus Pathway mend00010   Glycolysis / Gluconeogenesis mend00020   Citrate cycle (TCA cycle) mend00620   Pyruvate metabolism mend00633   Nitrotoluene degradation mend00640   Propanoate metabolism mend00650   Butanoate metabolism mend00680   Methane metabolism mend00720   Other carbon fixation pathways mend01100   Metabolic pathways mend01110   Biosynthesis of secondary metabolites mend01120   Microbial metabolism in diverse environments mend01200   Carbon metabolism mend01210   2-Oxocarboxylic acid metabolism Module mend_M00307   Pyruvate oxidation, pyruvate => acetyl-CoA mend_M00620   Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate Brite KEGG Orthology (KO) [BR:mend00001]  09100 Metabolism   09101 Carbohydrate metabolism    00010 Glycolysis / Gluconeogenesis     L6E24_08515    00020 Citrate cycle (TCA cycle)     L6E24_08515    00620 Pyruvate metabolism     L6E24_08515    00640 Propanoate metabolism     L6E24_08515    00650 Butanoate metabolism     L6E24_08515   09102 Energy metabolism    00720 Other carbon fixation pathways     L6E24_08515    00680 Methane metabolism     L6E24_08515   09111 Xenobiotics biodegradation and metabolism    00633 Nitrotoluene degradation     L6E24_08515 Enzymes [BR:mend01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.1  pyruvate synthase      L6E24_08515 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_6 Fer4_7 Fer4_2 Fer4_21 Fer4_10 Fer4_9 Fer4_16 Fer4_8 Fer4_15 Fer4_4 Fer4_17 Fer4_13 Fer4_3 Fn3_VIN3 Motif Other DBs NCBI-ProteinID:  UUX91422 UniProt:  A0A9E7TGM7 LinkDB All DBs Position complement(1942198..1942458) Genome browser AA seq 86 aa AA seqDB search MALSVGCTSRPGKARDNKTGSWRVFKPEIDSDKCNKCGTCTMICPEVCIEESKEGYPEVD YDFCKECGMCAEECPKDAIEMKQEEK NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atggcactttcagtcggatgcacatcaagaccgggaaaggcaagagacaataagaccgga tcgtggcgcgtgttcaaaccggagattgactcagataaatgcaacaagtgcggcacatgc acgatgatctgcccggaagtctgcattgaagagagcaaagaaggctatcctgaggttgat tatgacttctgcaaagagtgtggcatgtgcgccgaggaatgcccaaaggatgcaattgag atgaaacaggaggagaaataa

DBGET integrated database retrieval system