Micromonospora endophytica: Jiend_53420 Help Entry Jiend_53420       CDS       T08807                                  Symbol acpP_2 Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism meno  Micromonospora endophytica Pathway meno00998   Biosynthesis of various antibiotics meno01100   Metabolic pathways meno01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:meno00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Jiend_53420 (acpP_2)    00074 Mycolic acid biosynthesis     Jiend_53420 (acpP_2)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Jiend_53420 (acpP_2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  BCJ61920 LinkDB All DBs Position 5504566..5504823 Genome browser AA seq 85 aa AA seqDB search MERHEIVEKIQAALAEVLMRDFGPLSEGTRLFEDMHLDSTAILELLMALEDNIGIEVDPE NLNMDDFRTVGTLTDFLERARKVSS NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atggaacgccacgagatcgtcgagaagatccaggccgcgctggccgaggtgctgatgcgt gacttcggcccgctgtccgagggcacccggctcttcgaggacatgcacctggattccacc gccatcctcgaactgctcatggcccttgaggacaacatcggcatcgaggtggaccccgag aacctgaacatggacgacttccgcacggtgggcaccctgacggacttcctggagcgggcc cggaaggtgagttcctga

DBGET integrated database retrieval system