Methylobacterium sp. NMS14P: LOK46_04175
Help
Entry
LOK46_04175 CDS
T10783
Symbol
murI
Name
(GenBank) glutamate racemase
KO
K01776
glutamate racemase [EC:
5.1.1.3
]
Organism
mens Methylobacterium sp. NMS14P
Pathway
mens00470
D-Amino acid metabolism
mens01100
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:
mens00001
]
09100 Metabolism
09106 Metabolism of other amino acids
00470 D-Amino acid metabolism
LOK46_04175 (murI)
09180 Brite Hierarchies
09181 Protein families: metabolism
01011 Peptidoglycan biosynthesis and degradation proteins [BR:
mens01011
]
LOK46_04175 (murI)
Enzymes [BR:
mens01000
]
5. Isomerases
5.1 Racemases and epimerases
5.1.1 Acting on amino acids and derivatives
5.1.1.3 glutamate racemase
LOK46_04175 (murI)
Peptidoglycan biosynthesis and degradation proteins [BR:
mens01011
]
Precursor biosynthesis
Racemase
LOK46_04175 (murI)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Asp_Glu_race
GumK_N
Epimerase_2
DUF1919
Motif
Other DBs
NCBI-ProteinID:
WCS26043
LinkDB
All DBs
Position
complement(880005..880880)
Genome browser
AA seq
291 aa
AA seq
DB search
MRIDLMAGASLSAAALRCAAEPTILVFDSGLGGLTVLDAVRRARPDARYVYVGDDAAFPY
GRLSEATLVARVLTVMERLVATHRPDLVVIACNTASTLVLPALRQRFTTPFVGVVPPIKP
AAEATRSRLVTLLATPGTVARSYTHDLIATYAGSCAVTLVGSQNLAGFAEAELAGAPVDD
ATLAAEIAPCFVTEADGRRTDVVCLACTHYPLLLPRLQAVAPWPVAWIDPAPAIARRVVQ
LIGPLPREADRHGSALGAFTAGTCLTDALRTALAARGIGDVAVEAVPLPMQ
NT seq
876 nt
NT seq
+upstream
nt +downstream
nt
atgcggatcgatctgatggccggggccagcctgtccgccgccgctctgcgctgtgccgcc
gagccgaccattctggtgttcgattccggcctcggcggcctgaccgtcctcgacgcggtg
cggcgcgcccgtccggatgcccgctacgtctacgtcggcgacgacgccgccttcccgtac
ggccggctctcggaggcgaccctcgtcgcccgcgtcctcaccgtgatggagcggctggtc
gcgacccaccggcccgacctcgtggtcatcgcctgcaacaccgcctcgacgctggtgctc
ccggcgctgcgccagcgcttcacgacgcccttcgtgggagtggtcccgccgatcaagccg
gccgccgaggcgacgcgctcgcggctcgtgacgctgctggcgacgcccggcacggtggcg
cgctcctacacccacgacctgatcgcgacctacgccgggtcctgcgcggtgacgctggtc
ggctcgcagaacctcgccggcttcgcggaggccgaactcgcgggcgcgccggtggacgac
gccaccctcgccgccgagatcgccccctgcttcgtcaccgaggcggacgggcgtcgcacc
gacgtggtctgcctcgcctgcacccattatcccctgctgctgccgcgcctccaggcggtc
gcgccctggccggtggcctggatcgacccggcgcccgccatcgcccggcgcgtcgtgcag
ctgatcggccccctcccccgcgaggcggaccggcacggctcggcgctgggcgctttcacg
gccggcacctgcctgaccgacgccctgcgcacggccctcgcggcccgggggatcggcgac
gtcgccgtggaggcggtcccgctgccgatgcagtga
DBGET
integrated database retrieval system