Methylobacterium sp. NMS14P: LOK46_17230 Help Entry LOK46_17230       CDS       T10783                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism mens  Methylobacterium sp. NMS14P Pathway mens00261   Monobactam biosynthesis mens01100   Metabolic pathways mens01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mens00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     LOK46_17230  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:mens01008]     LOK46_17230 Polyketide biosynthesis proteins [BR:mens01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     LOK46_17230 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  WCS22927 LinkDB All DBs Position 3592146..3592379 Genome browser AA seq 77 aa AA seqDB search MAFDREDTLFYVVMNHEEQYSIWPSYRDIPDGWRAVGDPRAKADCLAYIDEVWTDMRPLS LRRHMEAQERDAGGART NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggcgttcgatcgcgaagatacgctcttctacgtggtgatgaatcacgaggagcaatac tcgatctggccgagctaccgcgacataccggacgggtggcgcgcggtgggcgacccgcgc gcgaaggccgattgcctggcctatatcgacgaggtctggaccgacatgcggcccctgagc ctgcgccgacacatggaggcacaggagcgggacgcgggcggcgcgcggacgtga

DBGET integrated database retrieval system