Candidatus Moranella endobia PCVAL: MPC_255 Help Entry MPC_255           CDS       T02613                                  Symbol groS Name (GenBank) 10 kDa chaperonin   KO K04078   chaperonin GroES Organism meo  Candidatus Moranella endobia PCVAL Brite KEGG Orthology (KO) [BR:meo00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:meo03110]     MPC_255 (groS)    03029 Mitochondrial biogenesis [BR:meo03029]     MPC_255 (groS) Chaperones and folding catalysts [BR:meo03110]  Heat shock proteins   HSP10    MPC_255 (groS) Mitochondrial biogenesis [BR:meo03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     MPC_255 (groS) SSDB OrthologParalogGFIT Motif Pfam:  Cpn10 DUF7205 Motif Other DBs NCBI-ProteinID:  AGJ61291 LinkDB All DBs Position complement(283033..283326) Genome browser AA seq 97 aa AA seqDB search MKIRPLHDRVIVKRKEVEAKSAGGIMLTGAAAGKSTRGEVLAVGNGRILDTGDVKALDVK VGDLVVFNDGYGVKVEKIDNEEVLIMSESDILAVVEK NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgaaaattcgtccattacatgatcgcgttattgtcaagcgtaaagaagttgaagcaaag tctgctggcggcatcatgctgactggtgccgcggctggcaagtcaacgcgcggtgaagta ctggctgtaggtaacggccgtattcttgacaccggcgacgtgaaagcgctagacgtaaaa gttggcgatctcgttgttttcaatgacggatatggcgtaaaggttgagaaaatcgacaac gaagaagtgcttattatgtccgaaagcgacattttagctgtcgttgagaagtag

DBGET integrated database retrieval system