Candidatus Moranella endobia PCVAL: MPC_461 Help Entry MPC_461           CDS       T02613                                  Symbol acpP Name (GenBank) Acyl Carrier Protein   KO K02078   acyl carrier protein Organism meo  Candidatus Moranella endobia PCVAL Pathway meo01100   Metabolic pathways meo01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:meo00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     MPC_461 (acpP)    00074 Mycolic acid biosynthesis     MPC_461 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     MPC_461 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Spectrin_SESTD1 DUF6952 Motif Other DBs NCBI-ProteinID:  AGJ61462 LinkDB All DBs Position complement(513283..513519) Genome browser AA seq 78 aa AA seqDB search MLNIEDSVKSVIAEQLGVKKEKIVNHASFVNDLGADSLDTVELVMALEEKFDTEITDDEA EKITTVQAAIDFIQARKQ NT seq 237 nt NT seq  +upstreamnt  +downstreamnt ttgttaaatatcgaagacagcgttaagtcagtcatagctgaacaactgggagtgaaaaaa gaaaaaattgtcaatcatgcttctttcgttaatgacctaggtgctgactctcttgacact gtggagttggtaatggcgctagaagaaaagttcgataccgaaattacggacgacgaagct gagaaaatcactactgtgcaagcagcgattgattttattcaggcacgcaagcagtaa

DBGET integrated database retrieval system