Methylovorus sp. MP688: MPQ_0819 Help Entry MPQ_0819          CDS       T01361                                  Symbol flgM Name (GenBank) anti-sigma-28 factor, FlgM   KO K02398   negative regulator of flagellin synthesis FlgM Organism mep  Methylovorus sp. MP688 Pathway mep02020   Two-component system mep02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:mep00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     MPQ_0819 (flgM)  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     MPQ_0819 (flgM)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:mep02035]     MPQ_0819 (flgM) Bacterial motility proteins [BR:mep02035]  Flagellar system   Flagellar assembly proteins    Others     MPQ_0819 (flgM) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FlgM Motif Other DBs NCBI-ProteinID:  ADQ83991 LinkDB All DBs Position 813780..814019 Genome browser AA seq 79 aa AA seqDB search MAQPPPGAPPPATESVTLSPLSSQLQSLEARIATQTVYDTDKVDAIKTAITNGQFQVDSG KVADGLIETVKDLLTSAKS NT seq 240 nt NT seq  +upstreamnt  +downstreamnt gtggcgcaaccgccaccgggggcccccccccccgccactgaaagcgtcacgctttcccca ctgtcctcgcaattgcaatccctggaagcacggatcgcgacgcagacggtatatgacaca gataaggtagacgccatcaaaacggcgattaccaacggccaattccaggtcgattccggc aaggttgccgatggcctgattgaaaccgttaaggatttattaacttcagccaaatcgtga

DBGET integrated database retrieval system