Macrococcus epidermidis: KFV12_05885 Help Entry KFV12_05885       CDS       T08412                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mepi  Macrococcus epidermidis Pathway mepi00998   Biosynthesis of various antibiotics mepi01100   Metabolic pathways mepi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mepi00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     KFV12_05885    00074 Mycolic acid biosynthesis     KFV12_05885   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     KFV12_05885 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L50 DUF7080 Motif Other DBs NCBI-ProteinID:  UTH17293 LinkDB All DBs Position 1111030..1111263 Genome browser AA seq 77 aa AA seqDB search MENFDKVKEIIVDRLGVDADKVTENASFKDDLGADSLDIAELVMELEDQFGMEIPDEEAE KINTVGDAVKYIESLEA NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggaaaacttcgacaaagtaaaagaaatcatcgttgaccgcttaggcgttgatgcggat aaagttactgaaaatgcttcatttaaagatgatttaggtgctgattctttagatatcgct gaattagtaatggaattagaagatcaatttggaatggaaattccggatgaagaagctgaa aaaatcaacacagttggtgatgcagttaaatacattgaatctttagaggcttaa

DBGET integrated database retrieval system