Methanosarcina sp. WWM596: MSWHS_2648 Help Entry MSWHS_2648        CDS       T03852                                  Name (GenBank) SSU ribosomal protein S27Ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism meq  Methanosarcina sp. WWM596 Pathway meq03010   Ribosome Brite KEGG Orthology (KO) [BR:meq00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     MSWHS_2648   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     MSWHS_2648  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:meq03011]     MSWHS_2648    04121 Ubiquitin system [BR:meq04121]     MSWHS_2648   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:meq04147]     MSWHS_2648 Ribosome [BR:meq03011]  Ribosomal proteins   Eukaryotes    Small subunit     MSWHS_2648   Archaea     MSWHS_2648 Ubiquitin system [BR:meq04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    MSWHS_2648 Exosome [BR:meq04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    MSWHS_2648   Exosomal proteins of colorectal cancer cells    MSWHS_2648 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Zn_ribbon_Nudix Ribosomal_L37e Rcat_RNF216 IBR_1 Zn_ribbon_RPB9 IBR Zn_Ribbon_TF Zn_ribbon_3 Cas12f1-like_TNB DUF6671 DUF1451 Zn_ribbon_11 MqsA_antitoxin Zn_ribbon_IS1595 Zn_ribbon_NOB1 Motif Other DBs NCBI-ProteinID:  AKB19511 LinkDB All DBs Position 3223403..3223552 Genome browser AA seq 49 aa AA seqDB search MAVKDYYKVQGDSVTRLKQFCPRCGPGIFLADHKNRLACGKCGYTEFKK NT seq 150 nt NT seq  +upstreamnt  +downstreamnt atggcagtaaaagattactacaaagtccagggcgactccgtaaccagactcaaacagttt tgtccaagatgcggaccaggtatattccttgccgaccacaaaaaccgtctcgcctgcggg aagtgcggctataccgagttcaagaagtaa

DBGET integrated database retrieval system