KEGG   Chelativorans sp. BNC1: Meso_1020
Entry
Meso_1020         CDS       T00374                                 
Name
(GenBank) biotin carboxyl carrier protein / biotin carboxylase
  KO
K01965  propionyl-CoA carboxylase alpha subunit [EC:6.4.1.3]
Organism
mes  Chelativorans sp. BNC1
Pathway
mes00280  Valine, leucine and isoleucine degradation
mes00630  Glyoxylate and dicarboxylate metabolism
mes00640  Propanoate metabolism
mes01100  Metabolic pathways
mes01110  Biosynthesis of secondary metabolites
mes01120  Microbial metabolism in diverse environments
mes01200  Carbon metabolism
Module
mes_M00741  Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA
Brite
KEGG Orthology (KO) [BR:mes00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Meso_1020
   00640 Propanoate metabolism
    Meso_1020
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Meso_1020
Enzymes [BR:mes01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.3  propionyl-CoA carboxylase
     Meso_1020
SSDB
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C PCC_BT Biotin_lipoyl Dala_Dala_lig_C Biotin_lipoyl_2 RimK ATP-grasp ATPgrasp_ST ATP-grasp_5 GARS_A DUF2118 Reovirus_L2_MT2 ATP-grasp_3
Other DBs
NCBI-ProteinID: ABG62417
UniProt: Q11JK8
LinkDB
Position
1119603..1121615
AA seq 670 aa
MFKKILIANRGEIACRIIKTARRMGIATVAVYSEADADALHAEMADEAVAIGPAPASQSY
LVAENIIAACKQIGAEAVHPGYGFLSENAEFCERLESEGIVFIGPKSKAIRAMGDKITSK
KIAAEAGVSTVPGHMGLVEDAGHAARIAAEIGYPVMIKASAGGGGKGMRIAWNDAEAREG
FERSRSEAASSFGDNRIFIEKFVEEPRHIEIQVLGDGFGNCIHLGERECSIQRRNQKVVE
EAPSPFLDAKTRAEMGAQAIALAKAVDYQSAGTVEFIVDSERNFYFLEMNTRLQVEHPVT
ELVTGIDLVEQMIRIAAGERLEIAQDDVKLKGWAIESRLYAEDPTRNFLPSIGRLARYRP
PEEGRSGETVLRNDTGVTEGSEISMFYDPMIAKLCTWAPDRLGAIDAMSQALDRFVVDGI
AHNIPFLAALMRHPRWREGRLSTAFIAEEYPDGFSIPAAGKAERAVFCAVALAIELIRRD
RLDRLPGRLAPHSGVMRRDWVVKLDREYIPVSLVEGTGSIPTDLSISIDGAAPVTLSSSW
HPGERIWTGRVGRKEAAVQIRPVLNGHELSWQGVASVVKVMTPRIAELDRLMPERKAADM
SKKLLCPMPGLVVSIAVSENQEVKAGEVLAIVEAMKMENVLRAERDCTVAAVLAAPGDSL
AVDAVIMEFA
NT seq 2013 nt   +upstreamnt  +downstreamnt
atgttcaaaaagatactcattgccaatcgtggcgagatcgcctgccgcatcatcaagacc
gcccgccggatgggaattgccacggtcgcggtctattcggaagccgatgcggatgccttg
catgcggagatggccgacgaagccgtggcgattggccctgctccggcaagccagagctac
ctcgtggccgagaacatcattgcggcctgcaagcagatcggagccgaggccgtgcatccc
ggttacggatttctctccgagaacgcggaattctgcgagcggctggaatcggagggcatt
gtcttcatcggcccgaaatccaaggccatccgcgccatgggcgacaagatcacctccaag
aagatcgcggcggaagcgggcgtatccaccgtgcccggccatatggggctggtggaggat
gccggccatgccgccaggattgccgctgagatcggctacccggtgatgatcaaggcctcc
gccggtggcggcggaaagggaatgcggatcgcctggaacgatgcggaggctcgcgaaggc
tttgagcgctcgcgctcggaagccgcctcgtctttcggcgacaaccgcattttcatcgag
aaattcgttgaggagccgcgccatatcgaaatccaggtgctgggggacggcttcggcaac
tgcatccatctgggcgagcgcgaatgctcgatccagcggcgcaaccagaaggtggtggag
gaggcgccttcgccctttctcgacgcgaagacccgcgcggaaatgggcgcgcaggccatc
gcgctggccaaggcggtggattatcagagcgcgggcacggtcgagttcatcgtcgacagc
gagcgcaacttctattttctcgaaatgaacacgcgcctgcaggtcgagcatccagtgacg
gagctcgtcacgggtatcgatctcgtcgagcagatgatccgcatcgccgccggagagaga
ttggagatcgcgcaggacgacgtaaagctcaagggctgggccatcgagagcaggctttat
gccgaggacccgacgcgcaacttccttccttcgatcgggcggcttgcgcggtaccgtccg
ccggaggaggggcggagcggagaaactgttttgcgcaatgacactggcgtgaccgagggg
tcggagatctcgatgttctacgatcccatgatcgccaagctttgcacctgggcaccggat
cgcctcggcgcgatcgatgcaatgtcgcaggcattggaccggttcgtcgtggacggcatc
gcccacaacattcccttccttgccgcgctcatgcgccatccccgctggcgtgaggggcgg
ctttcaaccgccttcatcgcggaggaataccctgacggcttctcgattcccgcggccggg
aaggcagagcgcgcggtgttctgcgcagtggcgcttgcaatcgaacttatccggcgtgac
cgcctcgaccggcttcccggtcggctcgcgccgcattcaggcgttatgcggcgcgattgg
gtggtgaagctggaccgcgaatatattccggtatcgttggtcgaggggacgggatccatc
ccgaccgatttgagcatttcgatagatggcgctgctccggtaacgctctcctcgtcctgg
catccgggcgaacggatatggacggggcgggtagggcgcaaggaagcggccgtgcagatc
cgccctgtgctgaatggtcatgagctttcctggcagggggtggcatcggtcgtgaaggtc
atgaccccgcgcatagccgagctcgacaggctgatgcccgaacgcaaagccgccgacatg
tccaaaaagctgctctgtccaatgcctggcctcgtggtctccatcgccgtgagcgagaat
caggaggtaaaggcaggcgaggtgctggcaatcgtggaagcgatgaagatggaaaatgtg
ctgcgcgcggagcgtgattgcacggtggccgccgtcctggcggcgccgggcgatagcctc
gccgtcgatgcggtcatcatggaatttgcctga

DBGET integrated database retrieval system