Chelativorans sp. BNC1: Meso_1767 Help Entry Meso_1767         CDS       T00374                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mes  Chelativorans sp. BNC1 Pathway mes01100   Metabolic pathways mes01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mes00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Meso_1767    00074 Mycolic acid biosynthesis     Meso_1767   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Meso_1767 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N ACP_SdgA_C Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  ABG63161 UniProt:  Q11HG4 LinkDB All DBs Position complement(1889359..1889595) Genome browser AA seq 78 aa AA seqDB search MSDTAERVKKIVVEHLGVDADKVTEQASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAA ETILTVGDAVKYIEKATA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagtgatactgcagagcgcgtcaagaagatcgttgttgagcatcttggcgtagacgcc gacaaggtgaccgaacaggccagctttatcgacgatctgggcgcggacagcctcgacacc gttgaactggtaatggccttcgaggaagaattcggtgtcgagatccccgacgacgcggcc gagacgatcctcacagtcggcgacgctgtgaagtacatcgaaaaggccacagcctga

DBGET integrated database retrieval system