Chelativorans sp. BNC1: Meso_3593
Help
Entry
Meso_3593 CDS
T00374
Name
(GenBank) ABC transporter related protein
KO
K11085
ATP-binding cassette, subfamily B, bacterial MsbA [EC:
7.5.2.6
]
Organism
mes
Chelativorans sp. BNC1
Pathway
mes02010
ABC transporters
Brite
KEGG Orthology (KO) [BR:
mes00001
]
09130 Environmental Information Processing
09131 Membrane transport
02010 ABC transporters
Meso_3593
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
mes02000
]
Meso_3593
Enzymes [BR:
mes01000
]
7. Translocases
7.5 Catalysing the translocation of carbohydrates and their derivatives
7.5.2 Linked to the hydrolysis of a nucleoside triphosphate
7.5.2.6 ABC-type lipid A-core oligosaccharide transporter
Meso_3593
Transporters [BR:
mes02000
]
ABC transporters, eukaryotic type
ABCB (MDR/TAP) subfamily
ABCB-BAC subgroup
Meso_3593
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
ABC_membrane
ABC_tran
SMC_N
RsgA_GTPase
AAA_29
AAA_22
ABC_ATPase
AAA_21
AAA_30
DEAD
AAA_24
AAA_23
AAA_16
DUF87
MMR_HSR1
DUF3995
P-loop_TraG
AAA_15
Motif
Other DBs
NCBI-ProteinID:
ABG64962
UniProt:
Q11CB3
LinkDB
All DBs
Position
complement(3874002..3875876)
Genome browser
AA seq
624 aa
AA seq
DB search
MGRLQRKPASFFGRLLGSFASGEMVSVIRRVIAENARDFLPHYRMAALCMLAIAATTGYM
AYLMKPLVDDVFYGHQWEKVIRICIEVVLIFAIRGFASYGQGVLLAKVGNNVVARYQRRL
FEHLMRLDIGFFTGTRSGQLAAQIAQNVTGIRDLLNVTLVATTRDIVTLIALVAVMVSTN
PALSLIALLIGPPLIYAVNYLARRLRRINREAVEINSRLLGAMQESVQGISIIKAFTMEN
VLTEKISGVILRAEERSNKIASVSERLGPVTEILAGIAIAAVIGLAGWRAQHYGIPPGDI
FAFITALLLAYDPARKLARTQVTLERALINAKMIYEILDIEPQQGDVANAKPLQVTAGNV
RFTDVRFSYLDHMPVLHGVSFEAMAGRTTAIVGPSGAGKSTLFALLQRFYDLDAGQITID
GQDISQVTKHSLRSKIAYVSQHPYLFEGTISDNIRYGRPDASDKEVEEAARLANAEDFIV
QQPQGYHTLVGENGVTLSGGQRQRLSIARAIVRNAPILLLDEATSALDNESEAKVQQALE
RVMAKRTTLVIAHRLSTVVNADHIVVLEEGQLVEEGTHRELVARPHGIYARFYRMQTERA
ENLLEGGEVDTNDATMEQIRGGRR
NT seq
1875 nt
NT seq
+upstream
nt +downstream
nt
ttgggcagactgcagcgcaaacccgcatctttcttcggcaggttgctgggcagcttcgcg
tccggagaaatggtttcggtcatccgccgtgtgatagcggagaacgcccgcgatttcctc
ccgcactatcgtatggctgcgctttgcatgttggccattgccgcgaccaccggctacatg
gcctatctgatgaagcccctcgtcgacgacgtgttctacggccaccagtgggagaaggtc
atccggatttgcattgaggtggtcctcatcttcgccatccggggcttcgcgagctacggc
cagggcgtcctgcttgcgaaagtaggcaacaatgttgtcgcgcgataccagcggcgtttg
ttcgagcatctcatgcggctcgatatcgggttcttcacgggaacgcgttcaggccagctt
gccgcccagattgcgcagaacgtcaccggcatacgcgacctgctcaatgtcacgctggtt
gccaccactcgcgacatcgtaacgctgatcgcgctcgttgccgtgatggtgagtaccaat
cccgccctttcgctgatcgcgctcctgatcgggccgccgctgatctatgccgtgaactac
ctagcgcgccgcttgcggcggatcaatcgcgaggcggtggaaatcaattcgcggctgctc
ggcgccatgcaggaatccgtccagggcatctccatcatcaaggccttcacgatggagaat
gtcctgacggagaagatatcgggcgttatcttgagagccgaagagcgctccaacaagatt
gccagcgtctcggaacggctggggcctgtcaccgaaatcctggccgggatcgcaatcgcc
gccgtcataggccttgccggctggcgtgctcagcactacgggataccaccgggtgatatc
ttcgcattcataacggcgctgctgcttgcctacgatcctgcgcgcaagctcgcccgcacg
caggtcaccctcgagcgggcgctgatcaacgccaagatgatttacgaaattctggacatc
gagccgcagcagggagatgtggcgaacgcgaaacccttgcaggtgactgcggggaatgtc
cgttttacggatgtccgcttttcctatctggatcatatgcctgtgcttcacggcgtgagc
ttcgaggcgatggccggcaggacgacggccatcgttggtccttcaggcgccggcaaatcg
acgctcttcgcgcttctgcagcgcttctacgatctcgacgcagggcagatcaccatcgac
gggcaggacatttcgcaggtcacgaagcactccctgcgctctaagatcgcctatgtttcg
cagcatccctatctgttcgagggcactattagcgacaatatccgctatgggcggcccgat
gccagcgacaaagaagtggaagaggcggcgcggcttgccaatgccgaggatttcattgtc
cagcaaccgcaaggttaccatactctcgtgggcgagaatggcgtgactctctccggcggt
cagcgccagcgcctttccattgcccgcgcgatagttcgcaacgcgcccatcctgctgctc
gacgaggcgacctccgcgctcgacaatgaatcggaagcgaaagtccagcaggcgcttgaa
cgcgtcatggccaagcgcaccacgctcgtcatcgcgcatcgtctttcgacggtcgtgaat
gcggatcacatcgtggtgctggaggaaggccaactcgttgaggaaggcactcaccgggaa
cttgtggcgaggccgcatggcatatatgcccgcttctatcgcatgcagacggaacgggcg
gagaacctcctggaaggtggggaagtggataccaacgatgccaccatggagcagataagg
ggtggtcgccgatga
DBGET
integrated database retrieval system