Methanogenium sp. S4BF: L1S32_11110 Help Entry L1S32_11110       CDS       T09590                                  Name (GenBank) 30S ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism mesb  Methanogenium sp. S4BF Pathway mesb03010   Ribosome Brite KEGG Orthology (KO) [BR:mesb00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     L1S32_11110   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     L1S32_11110  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:mesb03011]     L1S32_11110    04121 Ubiquitin system [BR:mesb04121]     L1S32_11110   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mesb04147]     L1S32_11110 Ribosome [BR:mesb03011]  Ribosomal proteins   Eukaryotes    Small subunit     L1S32_11110   Archaea     L1S32_11110 Ubiquitin system [BR:mesb04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    L1S32_11110 Exosome [BR:mesb04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    L1S32_11110   Exosomal proteins of colorectal cancer cells    L1S32_11110 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Ribosomal_L37e Lar_restr_allev Zn_ribbon_RPAB4 zf-HYPF Zn_ribbon_13 Zn_ribbon_11 Cas12f1-like_TNB DUF1451 Motif Other DBs NCBI-ProteinID:  WFN34377 LinkDB All DBs Position 2319401..2319556 Genome browser AA seq 51 aa AA seqDB search MAVKRCEYYSIEGNTAVPQRKSCPRCGPGVFMAEHKDRVSCGKCGYTEFKQ NT seq 156 nt NT seq  +upstreamnt  +downstreamnt atggccgtaaaacgctgtgaatattattccattgagggaaacactgcagttccccagcgc aagtcatgtccgcgctgtggtccgggtgtctttatggcagagcacaaggaccgtgtttca tgcggcaagtgcggatatacagaatttaagcaatag

DBGET integrated database retrieval system