Manihot esculenta (cassava): 110606657 Help Entry 110606657         CDS       T05761                                  Name (RefSeq) elongin-C   KO K03872   elongin-C Organism mesc  Manihot esculenta (cassava) Pathway mesc04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:mesc00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     110606657  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:mesc04121]     110606657    03400 DNA repair and recombination proteins [BR:mesc03400]     110606657 Ubiquitin system [BR:mesc04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      110606657    Cul5 complex      110606657 DNA repair and recombination proteins [BR:mesc03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      110606657 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ Motif Other DBs NCBI-GeneID:  110606657 NCBI-ProteinID:  XP_021601265 LinkDB All DBs Position 2:complement(9618405..9620890) Genome browser AA seq 98 aa AA seqDB search MRKEDTVKLISAEGFEFVIDKEAAMVSQTIRNMLTSPGSFAEAQHGEVTFPEISTTILEK VCQYFYWSLQYAKGKETEFQIEPELTLELMMAANYLHT NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgagaaaggaagatacagtgaagctgatcagcgcggaggggttcgagttcgtcatcgac aaggaagcggccatggtttcccaaaccatccgcaacatgctcacctctccaggtagtttc gctgaggcgcagcatggagaagtgacttttccggaaataagcaccaccattctagagaaa gtttgccagtatttctactggtcccttcaatatgccaagggaaaggagactgaattccag attgaacctgaactgaccctggagctgatgatggctgcgaattatctccatacttaa

DBGET integrated database retrieval system