Manihot esculenta (cassava): 110615167 Help Entry 110615167         CDS       T05761                                  Name (RefSeq) calmodulin-like protein 8   KO K02183   calmodulin Organism mesc  Manihot esculenta (cassava) Pathway mesc04016   MAPK signaling pathway - plant mesc04070   Phosphatidylinositol signaling system mesc04075   Plant hormone signal transduction mesc04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:mesc00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     110615167    04070 Phosphatidylinositol signaling system     110615167    04075 Plant hormone signal transduction     110615167  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     110615167  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:mesc01009]     110615167   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mesc04131]     110615167    03036 Chromosome and associated proteins [BR:mesc03036]     110615167   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mesc04147]     110615167 Protein phosphatases and associated proteins [BR:mesc01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      110615167 Membrane trafficking [BR:mesc04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     110615167 Chromosome and associated proteins [BR:mesc03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      110615167 Exosome [BR:mesc04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    110615167 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 EF-hand_9 AIF-1 SPARC_Ca_bdg Dockerin_1 EH EF_EFCAB10_C SPEF2_C PA_Ig-like DUF5580_M Fe_hyd_lg_C CdiI_ImmP UPF0154 TMP_3 Motif Other DBs NCBI-GeneID:  110615167 NCBI-ProteinID:  XP_021612584 LinkDB All DBs Position 5:complement(6770915..6773205) Genome browser AA seq 148 aa AA seqDB search MADALTVDQIADFREAFCLIDKDSDGFITVEELATTIQSLDGHPTKEEVQQMTSEVEVNG NGTIDFQEFLNIMGRKMKENVAEELKEAFKVFDRNQDGYISANELRQVMINMGERLTEEE AEQMIREADFDGDGLVSYEEFARIMMTA NT seq 447 nt NT seq  +upstreamnt  +downstreamnt atggcagatgcacttacagtagatcagattgcagacttccgagaggccttttgcttgatt gacaaggactcggatggcttcatcacagtggaagaactagcaaccactatacaatcgctg gatggacatcctacaaaagaagaagttcagcaaatgacaagtgaagttgaagttaatgga aatggaacaatagattttcaggagttcttgaacattatgggacggaaaatgaaggaaaat gttgctgaagagctaaaagaagctttcaaagtatttgacagaaaccaggatggatacata tcagccaatgagctaaggcaagtgatgataaatatgggagagagattgacagaggaggaa gctgaacagatgataagagaggcggattttgatggtgatggtcttgttagttatgaggaa tttgccaggataatgatgaccgcttaa

DBGET integrated database retrieval system