Manihot esculenta (cassava): 110619090
Help
Entry
110619090 CDS
T05761
Name
(RefSeq) arogenate dehydrogenase 1, chloroplastic
KO
K15227
arogenate dehydrogenase (NADP+), plant [EC:
1.3.1.78
]
Organism
mesc
Manihot esculenta (cassava)
Pathway
mesc00400
Phenylalanine, tyrosine and tryptophan biosynthesis
mesc01100
Metabolic pathways
mesc01110
Biosynthesis of secondary metabolites
mesc01230
Biosynthesis of amino acids
Module
mesc_M00040
Tyrosine biosynthesis, chorismate => arogenate => tyrosine
Brite
KEGG Orthology (KO) [BR:
mesc00001
]
09100 Metabolism
09105 Amino acid metabolism
00400 Phenylalanine, tyrosine and tryptophan biosynthesis
110619090
Enzymes [BR:
mesc01000
]
1. Oxidoreductases
1.3 Acting on the CH-CH group of donors
1.3.1 With NAD+ or NADP+ as acceptor
1.3.1.78 arogenate dehydrogenase (NADP+)
110619090
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
F420_oxidored
2-Hacid_dh_C
Motif
Other DBs
NCBI-GeneID:
110619090
NCBI-ProteinID:
XP_021618036
LinkDB
All DBs
Position
7:complement(33869655..33871116)
Genome browser
AA seq
193 aa
AA seq
DB search
MSTSSSSQSSTLKIGIIGFGPFAQFLAKTMIKQGHILRATSRSDHSQLCQDLGISYFRDM
VTFLEADNDIILFCTSILSLLEDKETKGCRMLEMSCEEHDRMAARSQFLTHTIGRILSEM
EIKSIPMNTKGFESLVQLKEGTVKDSFDLFSGLFICIRFAKQELKNLEISFEKVKQKLLD
KMNVMQNVNDSNL
NT seq
582 nt
NT seq
+upstream
nt +downstream
nt
atgtctacttcatcttcaagccaatcctcaactcttaaaataggcataataggcttcggc
ccctttgcacagttcttggcgaaaaccatgatcaagcaaggccatatattgagagcaact
tctcgttctgatcactctcagctctgtcaagacttgggtatctcatacttcagggatatg
gttacatttcttgaagcagacaacgatatcattctgttttgtacgtcaatactctctctt
ctagaggataaagaaactaaaggatgtagaatgctggagatgtcttgtgaagaacatgat
agaatggctgctagaagtcaatttcttactcataccattggcaggattttgtcagaaatg
gagatcaagtccatacctatgaacacaaaaggctttgagtcacttgttcagttaaaagag
ggcactgtaaaggatagctttgatctgtttagtgggttatttatctgcattagatttgcc
aaacaagagctaaagaacctggaaatttcctttgaaaaggttaagcagaagctactagat
aagatgaacgtcatgcagaatgtaaatgactccaacctctaa
DBGET
integrated database retrieval system