Manihot esculenta (cassava): 110625467 Help Entry 110625467         CDS       T05761                                  Name (RefSeq) ubiquitin-like protein ATG12   KO K08336   ubiquitin-like protein ATG12 Organism mesc  Manihot esculenta (cassava) Pathway mesc04136   Autophagy - other Brite KEGG Orthology (KO) [BR:mesc00001]  09140 Cellular Processes   09141 Transport and catabolism    04136 Autophagy - other     110625467  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mesc04131]     110625467    04121 Ubiquitin system [BR:mesc04121]     110625467    03029 Mitochondrial biogenesis [BR:mesc03029]     110625467 Membrane trafficking [BR:mesc04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     110625467 Ubiquitin system [BR:mesc04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    110625467 Mitochondrial biogenesis [BR:mesc03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     110625467 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  APG12 ATG8 Motif Other DBs NCBI-GeneID:  110625467 NCBI-ProteinID:  XP_021626758 LinkDB All DBs Position 11:complement(2197926..2200458) Genome browser AA seq 96 aa AA seqDB search MASAAESPSSVRKVIVQLRATADAPILKQNKFKIPGTDKFAKVIDFLRRQLHRETVFVYI NSAFSPNPDELVIDLFNNFGVDGKLLVNYACSMAWG NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atggcatcggctgctgagtcgccgagttctgttcggaaagtgattgttcaattaagagca actgccgatgctcctatactcaagcagaacaagttcaagatacctggaactgataagttt gctaaagtgattgactttttgcggagacaacttcacagagagacagtgtttgtatatatc aacagtgcattctctccaaaccctgatgaattggttattgatctatttaataattttgga gttgatggtaaactactggtcaattatgcttgctccatggcatggggctaa

DBGET integrated database retrieval system