Manihot esculenta (cassava): 110627096 Help Entry 110627096         CDS       T05761                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism mesc  Manihot esculenta (cassava) Pathway mesc04145   Phagosome mesc04148   Efferocytosis mesc04517   IgSF CAM signaling mesc04518   Integrin signaling mesc04620   Toll-like receptor signaling pathway mesc05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:mesc00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     110627096    04518 Integrin signaling     110627096  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     110627096    04148 Efferocytosis     110627096  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     110627096  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     110627096  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mesc04131]     110627096   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mesc04147]     110627096    04031 GTP-binding proteins [BR:mesc04031]     110627096 Membrane trafficking [BR:mesc04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     110627096  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     110627096   Macropinocytosis    Ras GTPases     110627096  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     110627096 Exosome [BR:mesc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    110627096   Exosomal proteins of other body fluids (saliva and urine)    110627096   Exosomal proteins of colorectal cancer cells    110627096   Exosomal proteins of bladder cancer cells    110627096 GTP-binding proteins [BR:mesc04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     110627096 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  110627096 NCBI-ProteinID:  XP_021629024 LinkDB All DBs Position 11:19570377..19574554 Genome browser AA seq 198 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKL DLQDDKQFFIDHPGATPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQP PKQRRRKRRKAQKACSIL NT seq 597 nt NT seq  +upstreamnt  +downstreamnt atgagtgcttcgaggttcatcaagtgcgtcaccgttggtgatggtgctgttggcaagacg tgcatgcttatctcctacaccagcaacactttccctactgattatgtgcccacagtgttc gacaatttcagtgcaaatgtggttgttgatgggagcacagtcaatctagggttgtgggat acagctggccaggaggattataatagattaagacctttgagttatcgtggggcagatgtt tttctgcttgctttctctctcattagcaaggccagttatgaaaatgttgcaaagaagtgg attcctgaattgaggcattatgcacctggagtaccaattattcttgttgggaccaagctt gatctccaagatgataagcaattctttatagatcaccctggtgcaacacccattaccact gctcagggggaggaactaagaaagctaattggggctcctgtttacattgaatgcagttct aaaactcagcagaatgtgaaagctgtctttgatgcagccattaaagtggttctccagcca ccaaaacagaggaggagaaagagaagaaaggctcaaaaggcctgctccatattatga

DBGET integrated database retrieval system