Methanocaldococcus lauensis SG7: MLAUSG7_0123 Help Entry MLAUSG7_0123      CDS       T07631                                  Symbol rps27ae Name (GenBank) 30S ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism mesg  Methanocaldococcus lauensis SG7 Pathway mesg03010   Ribosome Brite KEGG Orthology (KO) [BR:mesg00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     MLAUSG7_0123 (rps27ae)   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     MLAUSG7_0123 (rps27ae)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:mesg03011]     MLAUSG7_0123 (rps27ae)    04121 Ubiquitin system [BR:mesg04121]     MLAUSG7_0123 (rps27ae)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mesg04147]     MLAUSG7_0123 (rps27ae) Ribosome [BR:mesg03011]  Ribosomal proteins   Eukaryotes    Small subunit     MLAUSG7_0123 (rps27ae)   Archaea     MLAUSG7_0123 (rps27ae) Ubiquitin system [BR:mesg04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    MLAUSG7_0123 (rps27ae) Exosome [BR:mesg04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    MLAUSG7_0123 (rps27ae)   Exosomal proteins of colorectal cancer cells    MLAUSG7_0123 (rps27ae) SSDB OrthologParalogGFIT Motif Pfam:  Ribosomal_S27 Rcat_RNF216 Ribosomal_L37e Zn_ribbon_Nudix GFA MqsA_antitoxin Zn_ribbon_NUD Cas12f1-like_TNB Motif Other DBs NCBI-ProteinID:  CAB3287296 UniProt:  A0A8D6SV54 LinkDB All DBs Position I:complement(109977..110159) Genome browser AA seq 60 aa AA seqDB search MTKGKKTAKYKYYKIEGDKVVRLKKFCPRCGPGVFMAEHLNRYSCGRCGYMEWKQPQKKE NT seq 183 nt NT seq  +upstreamnt  +downstreamnt atgacaaaaggtaaaaaaacagcaaaatacaaatattacaaaattgaaggagataaagtt gttagattaaagaagttttgcccaagatgtgggccgggagtttttatggctgagcactta aacagatactcctgtggaagatgtggatatatggaatggaaacagcctcaaaagaaagaa taa

DBGET integrated database retrieval system