Mesorhizobium sp. PAMC28654: LGH82_09440 Help Entry LGH82_09440       CDS       T10450                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mesi  Mesorhizobium sp. PAMC28654 Pathway mesi01100   Metabolic pathways mesi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mesi00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LGH82_09440    00074 Mycolic acid biosynthesis     LGH82_09440   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LGH82_09440 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  UDL91440 LinkDB All DBs Position complement(1847052..1847288) Genome browser AA seq 78 aa AA seqDB search MSDTAERVKKIVIEHLGVDADKVTEQASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAA ETILTVGDAVKYIDKASA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagtgacaccgcagagcgcgtcaagaagatcgtcatcgagcatcttggcgtcgatgcc gacaaggtgacggagcaggcaagcttcatcgatgatctgggcgccgacagcctcgacacg gttgaactcgtcatggcgttcgaagaagagttcggcgtcgaaatccccgacgatgcggcc gagaccattctgaccgtcggcgatgccgtgaagtacatcgacaaggcttcggcctga

DBGET integrated database retrieval system