Mesorhizobium sp. PAMC28654: LGH82_24105 Help Entry LGH82_24105       CDS       T10450                                  Symbol grxC Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism mesi  Mesorhizobium sp. PAMC28654 Brite KEGG Orthology (KO) [BR:mesi00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:mesi03110]     LGH82_24105 (grxC) Chaperones and folding catalysts [BR:mesi03110]  Protein folding catalysts   Protein disulfide isomerase    LGH82_24105 (grxC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin SH3BGR Glrx-like GST_N_3 Motif Other DBs NCBI-ProteinID:  UDL88216 LinkDB All DBs Position 4899569..4899838 Genome browser AA seq 89 aa AA seqDB search MVDVTIYTRMMCGYCAAAKRLLERKGVAYTEHDASFSPELRQEMISRAHGRATFPQIFIG DKHVGGCDDLHELEAEGRLDKLLTNGSTI NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atggtcgatgtcacgatctatacgcgcatgatgtgcggctattgcgccgccgccaagcgg ctgctcgagcgcaagggggttgcttataccgagcacgacgcctccttctcgccggagctg cgccaagaaatgatttcgcgtgctcatggccgcgcgacctttccgcagatattcatcggc gacaagcatgtcggcggctgcgatgatctccatgagctggaagcagaaggccggctggac aagctgctcaccaacggctcgacaatttga

DBGET integrated database retrieval system