Mesorhizobium sp. PAMC28654: LGH82_26860
Help
Entry
LGH82_26860 CDS
T10450
Symbol
petA
Name
(GenBank) ubiquinol-cytochrome c reductase iron-sulfur subunit
KO
K00411
ubiquinol-cytochrome c reductase iron-sulfur subunit [EC:
7.1.1.8
]
Organism
mesi Mesorhizobium sp. PAMC28654
Pathway
mesi00190
Oxidative phosphorylation
mesi01100
Metabolic pathways
mesi02020
Two-component system
mesi04148
Efferocytosis
Module
mesi_M00151
Cytochrome bc1 complex respiratory unit
Brite
KEGG Orthology (KO) [BR:
mesi00001
]
09100 Metabolism
09102 Energy metabolism
00190 Oxidative phosphorylation
LGH82_26860 (petA)
09130 Environmental Information Processing
09132 Signal transduction
02020 Two-component system
LGH82_26860 (petA)
09140 Cellular Processes
09141 Transport and catabolism
04148 Efferocytosis
LGH82_26860 (petA)
Enzymes [BR:
mesi01000
]
7. Translocases
7.1 Catalysing the translocation of protons
7.1.1 Linked to oxidoreductase reactions
7.1.1.8 quinol---cytochrome-c reductase
LGH82_26860 (petA)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
UCR_Fe-S_N
Rieske
DUF3493
Motif
Other DBs
NCBI-ProteinID:
UDL88704
LinkDB
All DBs
Position
5476453..5477013
Genome browser
AA seq
186 aa
AA seq
DB search
MSATEIHDPNRRDFLYVATGMAAVVGAGAFAWPFIDQMRPDASTLALASVEVDVGSLTPG
MSLIVKWRGKPVVVRNRTDKEMKDGEAVSLTDLKDPIARNANLPADAPATDANRTTPGKE
AWMVMVQVCTHLGCIPLGQEGDFGGWFCPCHGSQYDTAGRIRKGPAPENMAVPVFKFISD
TKILIG
NT seq
561 nt
NT seq
+upstream
nt +downstream
nt
gtgagcgcaaccgaaatccacgatcccaatcgtcgagactttctctacgtcgcaaccggc
atggccgctgtggttggcgcgggtgcgttcgcgtggccgttcatcgaccagatgcgtccc
gatgcctcgacgctggcgctcgcttcggtggaagtcgacgttggctcgctgacgccgggc
atgtcgctgatcgtcaagtggcgcggcaagccggtcgtggtgcgcaaccgcaccgacaaa
gagatgaaggacggcgaagccgtcagcctcacggatctgaaggacccgatcgcccgcaac
gccaacctgccggccgacgctccggcaaccgacgccaaccgcaccacgcccggtaaggaa
gcctggatggtgatggttcaggtctgcacgcatctgggttgcattccgctcggccaggaa
ggcgatttcggcggctggttctgcccgtgccacggttcgcaatacgacaccgccggccgc
atccgcaaaggaccggcgcctgaaaatatggcagtgccggtattcaagttcatttccgat
accaagatccttatcggttga
DBGET
integrated database retrieval system