Mesorhizobium sp. J8: MJ8_22300 Help Entry MJ8_22300         CDS       T10402                                  Name (GenBank) acyl carrier protein AcpP   KO K02078   acyl carrier protein Organism mesj  Mesorhizobium sp. J8 Pathway mesj01100   Metabolic pathways mesj01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mesj00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     MJ8_22300    00074 Mycolic acid biosynthesis     MJ8_22300   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     MJ8_22300 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  BCM18460 LinkDB All DBs Position 2449710..2449946 Genome browser AA seq 78 aa AA seqDB search MSDTAERVKKIVIEHLGVDADKVTEQASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAA ETILTVGDAVKYIDKASA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagtgacaccgcagagcgcgtcaagaagatcgtcatcgagcatctcggcgtcgatgcc gacaaggtgacggagcaggcgagcttcatcgacgatctgggcgcggacagcctcgacacg gtcgaactcgtcatggcgttcgaagaagaattcggcgtcgagatcccggacgatgccgcc gagaccatcctcaccgtcggcgacgccgtgaagtatatcgacaaggcctcggcctga

DBGET integrated database retrieval system