Methanoregula sp. SKADARSKE-2: METHP_00623 Help Entry METHP_00623       CDS       T09978                                  Name (GenBank) hypothetical protein   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism mesk  Methanoregula sp. SKADARSKE-2 Pathway mesk03010   Ribosome Brite KEGG Orthology (KO) [BR:mesk00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     METHP_00623   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     METHP_00623  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:mesk03011]     METHP_00623    04121 Ubiquitin system [BR:mesk04121]     METHP_00623   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mesk04147]     METHP_00623 Ribosome [BR:mesk03011]  Ribosomal proteins   Eukaryotes    Small subunit     METHP_00623   Archaea     METHP_00623 Ubiquitin system [BR:mesk04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    METHP_00623 Exosome [BR:mesk04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    METHP_00623   Exosomal proteins of colorectal cancer cells    METHP_00623 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Zn_Ribbon_1 Rcat_RNF216 Zn_ribbon_Nudix MqsA_antitoxin Zn_ribbon_RPB9 Cas12f1-like_TNB Ribosomal_L37e Zn_ribbon_3 Zn_ribbon_RPAB4 DZR Zn_ribbon_NUD Zn_ribbon_NOB1 Lar_restr_allev Baculo_ME53 DUF1451 Zn_ribbon_13 Motif Other DBs NCBI-ProteinID:  WML67138 LinkDB All DBs Position 548141..548326 Genome browser AA seq 61 aa AA seqDB search MAAAKKAAVAKGPKRGDHYKVEGAKVTTTKKFCPRCGPGVMMAEHKDRIACGKCGYTEFK K NT seq 186 nt NT seq  +upstreamnt  +downstreamnt atggcagcagcaaagaaggcagcggttgccaagggaccgaaacggggagaccactacaag gttgagggagcaaaagtaaccacaaccaaaaagttctgcccacgctgcggacccggtgtc atgatggccgagcacaaggaccggattgcatgcgggaaatgcggctatactgaattcaag aaataa

DBGET integrated database retrieval system