Methanoregula sp. SKADARSKE-2: METHP_00626 Help Entry METHP_00626       CDS       T09978                                  Name (GenBank) 50S ribosomal protein L40e   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism mesk  Methanoregula sp. SKADARSKE-2 Pathway mesk03010   Ribosome Brite KEGG Orthology (KO) [BR:mesk00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     METHP_00626   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     METHP_00626  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:mesk03011]     METHP_00626    04121 Ubiquitin system [BR:mesk04121]     METHP_00626 Ribosome [BR:mesk03011]  Ribosomal proteins   Eukaryotes    Large subunit     METHP_00626   Archaea     METHP_00626 Ubiquitin system [BR:mesk04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    METHP_00626 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ribosomal_L40e DZR Zn_Ribbon_1 Zn_ribbon_3 DZR_2 DUF6079_6th Zn_ribbon_ZPR1 Zn_ribbon_RPAB4 Motif Other DBs NCBI-ProteinID:  WML67141 LinkDB All DBs Position 550543..550689 Genome browser AA seq 48 aa AA seqDB search MAKFPEAEARLLNVKICMHCNARNAIRATSCRKCGYQNLRPKNKERKA NT seq 147 nt NT seq  +upstreamnt  +downstreamnt atggcaaagtttccagaagccgaagcacggttactcaatgtaaaaatatgcatgcactgt aacgcccgcaatgcgatccgcgccaccagctgccgcaagtgcggttaccagaatctccgc cccaagaacaaggaaaggaaagcgtaa

DBGET integrated database retrieval system