Methylobacter sp. S3L5C: KKZ03_06985 Help Entry KKZ03_06985       CDS       T08037                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mesl  Methylobacter sp. S3L5C Pathway mesl01100   Metabolic pathways mesl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mesl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     KKZ03_06985 (acpP)    00074 Mycolic acid biosynthesis     KKZ03_06985 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     KKZ03_06985 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF5783 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  UOA09991 LinkDB All DBs Position 1508352..1508582 Genome browser AA seq 76 aa AA seqDB search MSNIEERVKKIVAEQLGVKEDIAIDASFVDDLGADSLDTVELVMALEEEFECEIPDDEAE KITTVQQAIDYVGKHA NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgagtaacattgaagaacgagtaaaaaagattgttgcagagcaattaggtgttaaagaa gatatcgctatcgatgcttcatttgtggatgatcttggtgccgattctctggatacagtt gaactcgttatggctcttgaagaagaatttgaatgcgaaattccagacgatgaagctgaa aaaattactactgttcagcaagctattgattacgtaggaaaacacgcgtaa

DBGET integrated database retrieval system