Methylobacter sp. S3L5C: KKZ03_07230 Help Entry KKZ03_07230       CDS       T08037                                  Symbol ftsL Name (GenBank) cell division protein FtsL   KO K03586   cell division protein FtsL Organism mesl  Methylobacter sp. S3L5C Brite KEGG Orthology (KO) [BR:mesl00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mesl03036]     KKZ03_07230 (ftsL) Chromosome and associated proteins [BR:mesl03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     KKZ03_07230 (ftsL) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FtsL DivIC Motif Other DBs NCBI-ProteinID:  UOA10737 LinkDB All DBs Position 1561587..1561847 Genome browser AA seq 86 aa AA seqDB search MNRLVSVVGIVLLLSALAVIYSKYYSRLIFIEIQKQERALDQYEVEWGQMQLELTMLAEQ NRIELVAREQLKLVMPLREKIIYIKP NT seq 261 nt NT seq  +upstreamnt  +downstreamnt ataaatcggctggtaagtgtggtaggtatcgtacttttattgtcggcgttagcagtgatt tatagtaaatactactcacgtttgatttttattgagatccaaaaacaggaaagagctttg gatcaatatgaagttgaatggggacagatgcagttagagttgactatgctggcagaacaa aatcggatagaactggtggcacgcgagcaattgaagttggttatgccattacgagaaaaa attatttatatcaaaccgtaa

DBGET integrated database retrieval system