Methylobacter sp. S3L5C: KKZ03_10375 Help Entry KKZ03_10375       CDS       T08037                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mesl  Methylobacter sp. S3L5C Pathway mesl01100   Metabolic pathways mesl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mesl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     KKZ03_10375    00074 Mycolic acid biosynthesis     KKZ03_10375   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     KKZ03_10375 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF4047 Motif Other DBs NCBI-ProteinID:  UOA10592 LinkDB All DBs Position 2333973..2334221 Genome browser AA seq 82 aa AA seqDB search MENELKQLIIDALDLEDISVADIDSHAPLFNEGLGLDSIDALELGLAIRKKYNVKIEAEK EDVVKIFSSVSTLADYIKSVQG NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggaaaatgaattaaagcaattgattatcgatgcactggatcttgaagatatcagtgtt gccgatatagatagtcatgcaccgctttttaatgaggggctggggctcgattcaatagat gcactggagctggggttggctatccgcaaaaaatacaatgtaaaaattgaggctgaaaaa gaagatgtcgtaaagattttttcttccgtttcaactttggccgattatattaaatcagtg cagggttaa

DBGET integrated database retrieval system