Methylobacter sp. S3L5C: KKZ03_10380 Help Entry KKZ03_10380       CDS       T08037                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mesl  Methylobacter sp. S3L5C Pathway mesl01100   Metabolic pathways mesl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mesl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     KKZ03_10380    00074 Mycolic acid biosynthesis     KKZ03_10380   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     KKZ03_10380 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding CagD Prenyltransf Motif Other DBs NCBI-ProteinID:  UOA10593 LinkDB All DBs Position 2334229..2334477 Genome browser AA seq 82 aa AA seqDB search MNNREEILSAIKTILVEMFEVDEKAITLEARLYQDLDFDSIDAVDMIVRIKEMTGKSVKP EDFKSARTISDVVEAVYSMIHD NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgaataatcgtgaagaaattttaagtgctattaaaactattttggtcgagatgtttgaa gtcgatgaaaaagcgattacgctggaagcacgcttataccaagatcttgatttcgatagt attgatgccgtcgatatgattgtgcggattaaggaaatgaccggaaaatcggttaaaccc gaagatttcaagagcgcccgcactatctccgatgtggttgaagccgtttacagtatgatc catgattag

DBGET integrated database retrieval system