Mesorhizobium sp. Pch-S: C1M53_03155 Help Entry C1M53_03155       CDS       T05918                                  Name (GenBank) F0F1 ATP synthase subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism mesp  Mesorhizobium sp. Pch-S Pathway mesp00190   Oxidative phosphorylation mesp01100   Metabolic pathways Module mesp_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:mesp00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     C1M53_03155  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:mesp00194]     C1M53_03155 Photosynthesis proteins [BR:mesp00194]  Photosystem and electron transport system   F-type ATPase [OT]    C1M53_03155 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  QAZ42120 LinkDB All DBs Position complement(670964..671188) Genome browser AA seq 74 aa AA seqDB search MDAEAAKYIGAGIACLGMGGAGIGLGNIFGSYLAGALRNPSAADGQFGRLIFGFAVTEAL GIFSLLIALLALFG NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atggacgctgaagccgcaaagtacatcggtgctggtatcgcttgcctgggcatgggcggc gcaggcatcggcctcggcaacatcttcggcagctacctggctggcgctctgcgcaacccg tcggctgctgacggccagttcggccgcctgattttcggcttcgccgtgacggaagctctg ggcatcttctcgctgctcatcgctctgctggcgctgttcggctga

DBGET integrated database retrieval system