Mesorhizobium sp. Pch-S: C1M53_03865
Help
Entry
C1M53_03865 CDS
T05918
Symbol
phnC
Name
(GenBank) phosphonate ABC transporter ATP-binding protein
KO
K02041
phosphonate transport system ATP-binding protein [EC:
7.3.2.2
]
Organism
mesp
Mesorhizobium sp. Pch-S
Pathway
mesp02010
ABC transporters
Brite
KEGG Orthology (KO) [BR:
mesp00001
]
09130 Environmental Information Processing
09131 Membrane transport
02010 ABC transporters
C1M53_03865 (phnC)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
mesp02000
]
C1M53_03865 (phnC)
Enzymes [BR:
mesp01000
]
7. Translocases
7.3 Catalysing the translocation of inorganic anions and their chelates
7.3.2 Linked to the hydrolysis of a nucleoside triphosphate
7.3.2.2 ABC-type phosphonate transporter
C1M53_03865 (phnC)
Transporters [BR:
mesp02000
]
ABC transporters, prokaryotic type
Phosphate and amino acid transporters
Phosphonate transporter
C1M53_03865 (phnC)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
ABC_tran
AAA_21
AAA_29
nSTAND1
RsgA_GTPase
AAA_16
AAA_23
NACHT
AAA_25
AAA_33
AAA_22
MMR_HSR1
FtsK_SpoIIIE
AAA_28
nSTAND3
Roc
AAA_5
AAA_19
TsaE
cobW
AAA_15
NB-ARC
Dynamin_N
G-alpha
Motif
Other DBs
NCBI-ProteinID:
QAZ42233
LinkDB
All DBs
Position
complement(821068..821919)
Genome browser
AA seq
283 aa
AA seq
DB search
MNAISIRNLSKNFGKKRALDNVSLDIGKGEMVALIGASGSGKSTLLRHICGLETGQTGSS
TIEIFGASLQTNGRLSGGARGLRRNIGVIFQQFNLVSRLSVLSNVLIGNLGRIPVWRGTL
GLFSAEEKRLAREALAKVGIPEVAWQRASTLSGGQQQRAAIARTLVQRSNILLADEPIAS
LDPSSARRVMEVLAGVNREDGITCVVSLHQVEYARRYCPRTIALKDGRVVFDGPSSRLTH
RTLVELYGSNSEELILPEAVPDFVPEYPEPATTKNPDMAPAFA
NT seq
852 nt
NT seq
+upstream
nt +downstream
nt
atgaacgccatcagcatacgcaacctgtcgaagaattttggcaagaagcgtgcactcgac
aacgtcagtctcgacatcggcaagggcgaaatggttgcgctgattggcgcctccggctcc
ggcaagagcacattgctgcgccacatctgcggactggagacagggcagacgggctccagc
acgatcgagatcttcggcgccagcctgcagaccaatggccggctctccggtggcgcccgt
gggcttcggcgcaacatcggcgtgatcttccagcagttcaacctagtcagccggctctcg
gtgctctccaacgtgctgatcggcaatctcggccgcattccggtgtggcgcggtacgctc
ggcctgttcagcgccgaggaaaagcggctcgcccgcgaagcgctggccaaggtcggcatt
ccggaggtcgcatggcagcgcgcctcgacactgtcgggcggccagcagcagcgcgcggcg
atcgcccgcacgctggtgcagcgctccaacatcctgctcgccgacgagccgatagcctcg
ctcgatccgtcttccgcgcgccgggtcatggaagtgctggccggcgtcaaccgcgaggac
ggcatcacctgcgtggtgtcgctgcaccaggtcgaatacgcgcgccgctactgcccgcgc
accatcgccctgaaggacggccgcgtcgtgttcgacggcccgtcctccaggctcacccac
agaacactggtcgaactctacggctcgaattccgaggagttgatcctgcccgaggctgtt
ccggatttcgtccccgaatacccggaacctgcaaccaccaagaacccggacatggcgccg
gctttcgcctga
DBGET
integrated database retrieval system