Mesorhizobium sp. Pch-S: C1M53_08115 Help Entry C1M53_08115       CDS       T05918                                  Name (GenBank) 4-oxalocrotonate tautomerase   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism mesp  Mesorhizobium sp. Pch-S Pathway mesp00362   Benzoate degradation mesp00622   Xylene degradation mesp01100   Metabolic pathways mesp01120   Microbial metabolism in diverse environments mesp01220   Degradation of aromatic compounds Brite KEGG Orthology (KO) [BR:mesp00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     C1M53_08115    00622 Xylene degradation     C1M53_08115    00621 Dioxin degradation     C1M53_08115 Enzymes [BR:mesp01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      C1M53_08115 SSDB OrthologParalogGFIT Motif Pfam:  Tautomerase Tautomerase_3 Motif Other DBs NCBI-ProteinID:  QAZ42944 LinkDB All DBs Position complement(1741718..1741930) Genome browser AA seq 70 aa AA seqDB search MPFANIKVPQAALSKAQKQEIVHRVTALFVDYFSEAARPHTMVLIEEVPDGGYGRADEVF VVPEAYRAKD NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgcccttcgccaacatcaaggtgccgcaagccgccctgtcgaaagcccagaagcaggag atcgtccaccgcgtcaccgccttgttcgtcgactatttcagcgaggccgcgcgcccgcac acgatggtgctgatcgaggaagtgccggacggcggctacggtcgcgccgacgaggtcttt gtcgtgcctgaggcctatcgggcgaaagactag

DBGET integrated database retrieval system