Mesorhizobium sp. Pch-S: C1M53_15090 Help Entry C1M53_15090       CDS       T05918                                  Symbol grxC Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism mesp  Mesorhizobium sp. Pch-S Brite KEGG Orthology (KO) [BR:mesp00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:mesp03110]     C1M53_15090 (grxC) Chaperones and folding catalysts [BR:mesp03110]  Protein folding catalysts   Protein disulfide isomerase    C1M53_15090 (grxC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin SH3BGR GST_N_3 Glrx-like Motif Other DBs NCBI-ProteinID:  QAZ44070 UniProt:  A0A4P6HA77 LinkDB All DBs Position 3214803..3215072 Genome browser AA seq 89 aa AA seqDB search MVDVTIYTRMMCGYCAAAKRLLDRKGVAYTEHDASFSPELRKEMIQRANGRATFPQIFVG DVHVGGCDDLHALEDAGRLDVLLAGAVAR NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atggtcgacgtgacgatctacacacgcatgatgtgcggctactgcgcagccgcaaagcgc cttctcgacagaaagggcgttgcctacaccgagcacgacgcgtccttctcgccggaactg cgcaaggaaatgatccagcgcgccaacggccgtgccaccttcccgcagattttcgtcggg gatgtccacgtcggcggttgtgacgatctgcatgcgttggaagacgccgggcggctcgat gtattgcttgccggtgctgtggcgcgctga

DBGET integrated database retrieval system