Mesorhizobium sp. Pch-S: C1M53_26015 Help Entry C1M53_26015       CDS       T05918                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mesp  Mesorhizobium sp. Pch-S Pathway mesp00998   Biosynthesis of various antibiotics mesp01100   Metabolic pathways mesp01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mesp00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     C1M53_26015    00074 Mycolic acid biosynthesis     C1M53_26015   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     C1M53_26015 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  QAZ45853 LinkDB All DBs Position 5540130..5540366 Genome browser AA seq 78 aa AA seqDB search MSDTAERVKKIVIEHLGVDADKVTEQASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAA ETILTVGDAVKYIDKASA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagtgacaccgcagagcgcgtcaaaaagatcgttatcgagcatctgggcgtcgatgcc gacaaagtgacggagcaggcctccttcatcgacgatctcggcgcggacagcctcgacacg gttgagcttgtcatggcgttcgaggaagagttcggcgtagaaatcccggacgacgcggca gagaccatcctcacggtcggcgacgccgtgaagtacatcgacaaggcctcggcctga

DBGET integrated database retrieval system