Mesorhizobium sp. 8: FGU64_02380 Help Entry FGU64_02380       CDS       T07809                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mesr  Mesorhizobium sp. 8 Pathway mesr01100   Metabolic pathways mesr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mesr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FGU64_02380    00074 Mycolic acid biosynthesis     FGU64_02380   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FGU64_02380 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF7080 Motif Other DBs NCBI-ProteinID:  QDB99340 UniProt:  A0A5B8AYF7 LinkDB All DBs Position 515558..515794 Genome browser AA seq 78 aa AA seqDB search MSDTAERVKKIVIEHLGVDADKVTEQASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAA ETILTVGDAVKYIDKASA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagtgacaccgcagagcgcgtcaagaagatcgttatcgagcatctgggcgtggatgcc gacaaggtgaccgaacaggcgagcttcatcgacgacctgggcgcggacagcctcgacacg gtcgaactggtcatggccttcgaggaagaattcggcgtcgagatccccgacgacgcggcc gagacgatcctcacggtcggcgacgccgtgaagtacatcgacaaggcttcggcctga

DBGET integrated database retrieval system