Mesorhizobium sp. ANAO-SY3R2: ABSY17_00440
Help
Entry
ABSY17_00440 CDS
T10784
Name
(GenBank) cyclic nucleotide-binding domain-containing protein
KO
K03321
sulfate permease, SulP family
Organism
mess Mesorhizobium sp. ANAO-SY3R2
Brite
KEGG Orthology (KO) [BR:
mess00001
]
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
mess02000
]
ABSY17_00440
Transporters [BR:
mess02000
]
Other transporters
Electrochemical potential-driven transporters [TC:
2
]
ABSY17_00440
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
cNMP_binding
Sulfate_transp
STAS
STAS_2
Motif
Other DBs
NCBI-ProteinID:
XHM74212
LinkDB
All DBs
Position
unnamed3:5524..7755
Genome browser
AA seq
743 aa
AA seq
DB search
MGEGTSDVVLAAGSQSGARHSNTNLIQQLALATPLAVVIGLDAIGFAIALASLMFAGELS
QGLGIAVTGALVCTILLSIFVGWRSDLKINMACAQDVGAAILAASLVGAVSSVAPGSKLA
TAFVIVAAATLATGTILFATGFLHAGRLVRFFPLEVLAGFMAATGFLLLIGGIAMVCHVE
PSLQGVLSIAPTQLLLVAPAVLLAGLIYLAMTYLRKPFMVLANLVGAALLFHGWLWLVGM
TQADAAGLGLLPMLPASQALQLPFPAMLSLVDWHAVLAAAPVIGTAALLSLFAAMMNISA
LELATGREIDVNREIRLTGAVNAVVSGFGGPPGYSDLATTQLLNKSGVTIRGTGFLVALV
ALLGLFFAADVVSLVPFFVSAGLVLYYGFDLVHDWLVATRKTFSFREWSVVVLIVAISVF
YSFAVAILAGFLIATVLFAYSYSHAPVIRNVTSLARLPSTTDRAPEEASVLVAQGKAVQI
IQAQGFLFFGTSEQVVDKVRQACAGDADMPLRSVIIDFSRVTDLDSASASAFKRIENLSE
SRGFKLSFCAIGPKIIGTLLRCGLDIAKGGRIPVYDDLDLALEEAEQDILKSAMPGMTGK
SLASHFARSPGHERQLEQLFAAMTREVYAPGEIIIKGGTPANDIFVVESGRAVVFRSAKE
ANRKRLRTMTAGAVLGELAYSMGMLRTADVVAEIETVLLRMSSRQADGLARENPPLAILF
NQLISRALAEKVLIANRMTEHVG
NT seq
2232 nt
NT seq
+upstream
nt +downstream
nt
atgggggaaggcacaagcgatgtcgtgctggctgctggttcgcaatccggcgcgaggcat
tcgaacacgaacctgatccagcagttggctcttgcgaccccattggccgtcgtcatcggg
ttggatgccatcggcttcgcaattgcgctcgcttcgctgatgtttgccggcgagctctcg
cagggccttggcatcgcggtcacgggggctttggtctgcaccatcctcctgtcgattttc
gtcggatggcgcagcgacctcaagatcaacatggcatgcgcgcaggatgtcggcgcagcg
attctcgctgcctccctggtcggcgccgtgtccagtgtcgcgccaggctcgaagctggcg
acggcctttgtcattgtcgccgcagctacgcttgcaaccggaacaatcctctttgccaca
ggcttcttgcatgccgggcgcctcgtgcggttctttccgctggaggtgctggcggggttc
atggccgcgacaggatttctgttgctgatcggtggcatcgccatggtctgccacgtggag
ccgagccttcagggcgtcttgtcgatcgcaccgactcagttgctgctcgtggcgcctgcg
gttcttttggccgggttgatctacctggcgatgacctatctgaggaagcctttcatggtg
ctggccaatcttgttggcgcagcgcttctcttccatggctggttgtggctggttggaatg
acgcaggcggatgcggccggtctcggcctgcttcccatgcttcccgcatcgcaggcgttg
caactgccgtttcccgccatgctgtcgctggtggattggcatgctgtcctcgcggcagcg
cctgtgatcggcaccgccgcacttctcagtctctttgccgccatgatgaatatttcggcg
ctggaactggctaccggcagggagatcgacgtcaaccgggagatcaggctgacgggcgcc
gtcaatgccgtggtctccggctttggcggtccgccgggctattccgacctggccactacg
caacttctcaacaagagcggtgtaacgatccgcggcaccggttttctcgtggcactggtg
gcgctgctgggtctgttttttgccgccgacgtcgtcagcctggtgccctttttcgtctcg
gcgggccttgttctctattacggcttcgatctggtgcatgactggcttgtcgcgacacgc
aagaccttcagcttccgagagtggagcgtcgtcgttctcattgtcgcgatatcggtcttc
tacagctttgcggtcgccattctcgccggctttctcatcgcgacggtccttttcgcctac
agttattcgcatgcgccggtgataagaaatgtgacgtcgctggcgcgcctgccgagcacg
acggatcgcgctccggaagaggctagcgtgctcgttgcccaaggcaaggccgtgcagatc
attcaggcgcagggctttctgttcttcggcacctcggaacaggtcgtcgacaaggtccgc
caagcctgcgccggcgacgccgatatgccgctgcgctccgtcatcatcgacttctcgcgt
gtcacggatttagacagcgcctcggccagcgcgttcaagcggatcgaaaatctctcggag
tcgcgtggcttcaagctgtcgttctgcgccatcgggcccaagatcatcggaacgttgctt
cgctgcggtctcgacatagccaaaggcgggcgaatcccggtctatgacgatctcgacctt
gctcttgaagaggcagaacaggacatcctgaaatcggccatgcccggcatgaccggaaaa
tctcttgccagtcattttgccagatcgcccggacatgaaaggcaactcgagcagctcttc
gcggccatgacacgcgaggtctatgcgcccggtgagataatcatcaagggcggaacgccg
gcgaacgacatattcgttgtggaatcgggccgagcggtcgtctttcgctccgccaaggag
gcgaaccgcaagcggctgcgcacgatgaccgcaggcgccgttctgggagaattggcctat
agcatgggcatgctgcgaacagcggatgtcgtggcggagatcgagaccgtcttgctacgc
atgtcgtccaggcaggccgatggcctggcgagggagaacccaccgcttgcaattctcttc
aaccagttgatcagtcgcgcactggccgaaaaagtgctcatcgccaaccgtatgaccgag
catgttgggtag
DBGET
integrated database retrieval system