Mesorhizobium sp. ANAO-SY3R2: ABSY17_17540 Help Entry ABSY17_17540      CDS       T10784                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mess  Mesorhizobium sp. ANAO-SY3R2 Pathway mess01100   Metabolic pathways mess01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mess00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ABSY17_17540    00074 Mycolic acid biosynthesis     ABSY17_17540   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ABSY17_17540 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N ACP_SdgA_C DUF7966 Motif Other DBs NCBI-ProteinID:  XHM75324 LinkDB All DBs Position complement(2600356..2600592) Genome browser AA seq 78 aa AA seqDB search MSDTAERVKKIVVEHLGVDADKVTEAASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAA ETILTVGDAVKFIDKASA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagtgacaccgcagagcgcgtcaagaagatcgttgtcgaacatcttggcgtcgacgcc gacaaggtgacggaagccgcaagcttcatcgatgacctgggcgcggacagcctcgacacg gtcgagctcgttatggcgttcgaagaagaattcggcgtcgagatccccgatgacgcggcc gagaccatcctgacggttggcgatgccgtgaagttcatcgacaaggcttcggcctga

DBGET integrated database retrieval system