Mesorhizobium sp. WSM1497: A9K65_005045 Help Entry A9K65_005045      CDS       T04915                                  Name (GenBank) 4-oxalocrotonate tautomerase   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism mesw  Mesorhizobium sp. WSM1497 Pathway mesw00362   Benzoate degradation mesw00621   Dioxin degradation mesw00622   Xylene degradation mesw01100   Metabolic pathways mesw01120   Microbial metabolism in diverse environments mesw01220   Degradation of aromatic compounds Brite KEGG Orthology (KO) [BR:mesw00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     A9K65_005045    00622 Xylene degradation     A9K65_005045    00621 Dioxin degradation     A9K65_005045 Enzymes [BR:mesw01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      A9K65_005045 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tautomerase Tautomerase_2 Tautomerase_3 DUF4875 RA_2 Motif Other DBs NCBI-ProteinID:  ARP62818 UniProt:  A0AAC9WNW4 LinkDB All DBs Position 1041104..1041310 Genome browser AA seq 68 aa AA seqDB search MPFVNIRIVKEVIAADPAGKKADIAKKVTAAIMDATGLSNDDVWVVFEEVNARDWYVGKT DVETLRKG NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atgccattcgtcaacatccgcatcgtcaaggaagtgatcgccgccgatccggcgggcaaa aaggcggatatcgccaagaaggtcaccgcggccatcatggacgccaccgggctgagcaac gacgatgtctgggtggtttttgaagaggtcaacgcccgcgattggtacgtggggaagacc gatgtggagacgctgcgaaaggggtag

DBGET integrated database retrieval system