Mesorhizobium sp. WSM1497: A9K65_015470 Help Entry A9K65_015470      CDS       T04915                                  Name (GenBank) 4-oxalocrotonate tautomerase   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism mesw  Mesorhizobium sp. WSM1497 Pathway mesw00362   Benzoate degradation mesw00621   Dioxin degradation mesw00622   Xylene degradation mesw01100   Metabolic pathways mesw01120   Microbial metabolism in diverse environments mesw01220   Degradation of aromatic compounds Brite KEGG Orthology (KO) [BR:mesw00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     A9K65_015470    00622 Xylene degradation     A9K65_015470    00621 Dioxin degradation     A9K65_015470 Enzymes [BR:mesw01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      A9K65_015470 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tautomerase Motif Other DBs NCBI-ProteinID:  ARP64609 UniProt:  A0AAC9S600 LinkDB All DBs Position 3191483..3191695 Genome browser AA seq 70 aa AA seqDB search MPFANIKLPQAALSKAQKEDLIHRTTAMFVDFFGEGVRPYTMVLVEEVADGGYGRADEVF VVPEVFRAKE NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgccattcgccaacatcaagctaccgcaagcggccctctccaaagcgcagaaggaagac ctcatccatcggacgaccgcgatgttcgtcgactttttcggtgagggcgtgcgcccctac acgatggtgctggtcgaggaggtcgccgacggaggctatggccgggccgacgaagtgttc gtcgtgccggaagtttttcgcgcgaaggagtag

DBGET integrated database retrieval system