Mesorhizobium sp. WSM1497: A9K65_024410 Help Entry A9K65_024410      CDS       T04915                                  Name (GenBank) DNA-binding protein HU   KO K03530   DNA-binding protein HU-beta Organism mesw  Mesorhizobium sp. WSM1497 Brite KEGG Orthology (KO) [BR:mesw00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:mesw03032]     A9K65_024410    03036 Chromosome and associated proteins [BR:mesw03036]     A9K65_024410    03400 DNA repair and recombination proteins [BR:mesw03400]     A9K65_024410 DNA replication proteins [BR:mesw03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     A9K65_024410 Chromosome and associated proteins [BR:mesw03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     A9K65_024410 DNA repair and recombination proteins [BR:mesw03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       A9K65_024410 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 DUF2267 HU-CCDC81_euk_1 Motif Other DBs NCBI-ProteinID:  ARP66139 UniProt:  A0AAC9S914 LinkDB All DBs Position complement(4969654..4969926) Genome browser AA seq 90 aa AA seqDB search MNKNELVSAVADAASISKGDAQSAVDAVFSVITGELKKGGDVRLVGFGNFTVSKRAASTG RNPQTGAEVKIPARTVPKFSAGKGLKDAVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaacaagaacgaactggtgtccgctgtcgccgacgccgcgagcatttcgaagggtgac gcgcagtcggcggtcgatgcggtattttccgtgatcaccggcgaactgaagaagggcggc gatgtccggcttgtcggctttggcaatttcaccgtgtcaaagcgtgccgcctcgaccggc cgcaatcctcagaccggcgccgaagtgaagatcccggcgcgtaccgtgccgaagttctcg gccggcaaaggcctcaaggacgcagtcaactaa

DBGET integrated database retrieval system