KEGG   Methylobacterium sp. 4-46: M446_2602
Entry
M446_2602         CDS       T00679                                 

Definition
(GenBank) dihydrofolate reductase
  KO
K17364  dihydromethanopterin reductase [EC:1.5.1.47]
Organism
met  Methylobacterium sp. 4-46
Pathway
met00790  Folate biosynthesis
met01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:met00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    M446_2602
Enzymes [BR:met01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.47  dihydromethanopterin reductase [NAD(P)+]
     M446_2602
SSDB
Motif
Pfam: DHFR_1
Other DBs
NCBI-ProteinID: ACA17041
UniProt: B0UL41
LinkDB
Position
2891040..2891447
AA seq 135 aa
MIDVRAMCAIGQRGQLGLDGRLPWEGNADPLYVEDVTRFFAETQGHVLIAGPKTIEAVPA
FAYRDRTIAIIRSHEDPAAVLARYSGRRIFVGGGVAVWNVYAPFIQQWDITRLPYDGEAD
RWFDPAWLVGGKLRG
NT seq 408 nt   +upstreamnt  +downstreamnt
atgatcgacgtgcgggcgatgtgcgccatcgggcagcggggccagctcggcctcgacggg
cggctgccctgggagggcaacgcggatccgctctacgtcgaggacgtgacccgcttcttc
gccgagacgcagggccacgtgctgatcgccggcccgaagacgatcgaggcggtgcccgcc
ttcgcgtaccgggaccggaccatcgccatcatccgctcgcacgaggatccggccgcggtg
ctcgcccgctacagcgggcggcggatcttcgtcggcggcggggtggcggtgtggaacgtc
tacgcgcccttcatccagcaatgggacatcacgcgcctgccctacgacggcgaggcggat
cgctggttcgaccccgcttggctggtgggcggcaagctgcgagggtga

DBGET integrated database retrieval system