Methylobacterium sp. 4-46: M446_3198 Help Entry M446_3198         CDS       T00679                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism met  Methylobacterium sp. 4-46 Pathway met01100   Metabolic pathways met01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:met00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     M446_3198    00074 Mycolic acid biosynthesis     M446_3198   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     M446_3198 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N DUF1493 DUF5783 DNA_Packaging_2 Motif Other DBs NCBI-ProteinID:  ACA17604 UniProt:  B0UNZ6 LinkDB All DBs Position complement(3542789..3543025) Genome browser AA seq 78 aa AA seqDB search MSDIADRVKKIVVEHLGVEAEKVTENANFIDDLGADSLDTVELVMAFEEEFNVEIPDDAA ETIQTVGDAIKFLEKNSG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgcggaccgggtgaagaagatcgttgtcgagcacctcggcgtggaggcc gagaaggtgaccgagaacgcgaacttcatcgacgatctcggggccgacagcctcgacacg gtcgagctggtgatggcgttcgaggaagagttcaacgtcgagatcccggacgacgcggcc gagacgatccagacggtcggcgacgcgatcaagttcctggagaagaactccggctga

DBGET integrated database retrieval system