Methylobacterium sp. 4-46: M446_3760 Help Entry M446_3760         CDS       T00679                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism met  Methylobacterium sp. 4-46 Pathway met01100   Metabolic pathways met01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:met00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     M446_3760    00074 Mycolic acid biosynthesis     M446_3760   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     M446_3760 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ACA18140 LinkDB All DBs Position 4197186..4197479 Genome browser AA seq 97 aa AA seqDB search MQTIPSASAYSTGDIERILLEIVRKQARNEGADWSLTTTMEEAQIDSFDLVELVFEVEDR FGVEVSFNANERPIGEMTFGDVIALIRGALASKEKAA NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgcagaccattccttccgcttcggcatactccaccggagatatcgagcgcatcctgctc gagatcgtccgcaagcaggcccgcaacgagggggccgattggtccctgaccaccacgatg gaggaggcgcagatcgattccttcgatctcgtcgaactcgtcttcgaggtggaggaccgc ttcggcgtcgaggtcagcttcaacgccaacgagcggccgatcggcgagatgaccttcggg gacgtgatcgcgctgatccgcggcgcgctggcctcgaaggagaaggcggcgtga

DBGET integrated database retrieval system