Methylobacterium sp. AMS5: Y590_13530 Help Entry Y590_13530        CDS       T04283                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism meta  Methylobacterium sp. AMS5 Pathway meta01100   Metabolic pathways meta01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:meta00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Y590_13530    00074 Mycolic acid biosynthesis     Y590_13530   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Y590_13530 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 ARPP-1 PP-binding_2 Motif Other DBs NCBI-ProteinID:  AMB45936 LinkDB All DBs Position 2928638..2928877 Genome browser AA seq 79 aa AA seqDB search MTMSGFYEELAEILEVEPDQMTADLRLENTSWDSLAVVSTIALIDEQYDRAVNATALAAC ETVGDIERLIAARPTESEA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgacaatgagcggcttttacgaagaactcgctgaaatccttgaggtcgagccggaccaa atgacggccgacctgcgcctggaaaatacgtcgtgggactcgctggctgtggtctccacc attgccctgatcgatgagcagtatgacagggctgtcaacgccacggccctcgctgcgtgc gagacagtcggcgacatcgagcgcttgattgcagcacgcccgaccgagagcgaggcgtag

DBGET integrated database retrieval system