Methylobacterium sp. AMS5: Y590_17575
Help
Entry
Y590_17575 CDS
T04283
Name
(GenBank) ATPase
KO
K07678
two-component system, NarL family, sensor histidine kinase BarA [EC:
2.7.13.3
]
Organism
meta
Methylobacterium sp. AMS5
Pathway
meta02020
Two-component system
Brite
KEGG Orthology (KO) [BR:
meta00001
]
09130 Environmental Information Processing
09132 Signal transduction
02020 Two-component system
Y590_17575
09180 Brite Hierarchies
09181 Protein families: metabolism
01001 Protein kinases [BR:
meta01001
]
Y590_17575
09183 Protein families: signaling and cellular processes
02022 Two-component system [BR:
meta02022
]
Y590_17575
Enzymes [BR:
meta01000
]
2. Transferases
2.7 Transferring phosphorus-containing groups
2.7.13 Protein-histidine kinases
2.7.13.3 histidine kinase
Y590_17575
Protein kinases [BR:
meta01001
]
Histidine kinases
NarL family
Y590_17575
Two-component system [BR:
meta02022
]
NarL family
BarA-UvrY (central carbon metabolism)
Y590_17575
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
HATPase_c
HisKA
Response_reg
Hpt
HAMP
CHASE8
CusS
Motif
Other DBs
NCBI-ProteinID:
AMB46747
LinkDB
All DBs
Position
complement(3775668..3778418)
Genome browser
AA seq
916 aa
AA seq
DB search
MRAPLSNPIRSLSGRLALAVASAVAIALLLLTGLSTWREVERYAAAKRDLLRMTAQILAA
SAAQATARGDEAAAQSTLRAIAHGEALVYASVERADGDILAEQGIGLRLSNDIDLDQGSV
SPLDLVTTRTLRVSVPILENARPIGRVVLVSDNRDLAERVTEVGLTAGLAGLLALALGLA
VSMGLQRSVTRPLAALARTMDGVRLGHDYSRRAEAGSGEVGALAESFNDLLRAVNERDRA
IARYNAGLEEEIRLRTHDLIEAKQSADEANAAKSVFLATMSHEIRTPMNGMLVMAELLAS
ADLPPRQQRYAKVIARSGQSLLAIINDILDFAKVEAGRLEVERIPLSPRDVADTVVTLFA
ERARSAGLDLAAQIDGDVPRSLLGDPVRLGQVLGNFVSNALKFTATGHVLVRMDMERDAS
GPVLRLAVSDTGIGIPQDRLSGIFTAFTQADQSIARRFGGTGLGLSIAERLIVAMGGRVG
VESRLGEGSTFWARIPVEGAEGAEPALRRAPALPAAFRLGALGGATRAALTADLQAAGFH
PAESGEGHWIVEAAELLASGRRPEGAGRVIALVPIGDTSGPELMRAGLADAVLRRPLAQA
EWRPLLAALAEGTALAFEAPAADESAASALPSFAGARVLLADDSAVNREVAAEALGRFGV
HDIVCVEDGGAAVEAAAAHRFDLVLMDGSMPVLDGFSAAVAIRAREARDGADRVPIVALT
AHVVGDGAESWQAAGMDGMLAKPFTLAQLGGLLAQHLQAAPLRDLAEIVTSEAPAPRISD
DVLLDEQTIANLEELGDRDFLARILRLYIAQAPRALLEFEGALARGDAPAVSRAAHGLKS
MSANIGAVQVKDRAGAIERTARDGDLTRLADAASGLDGLLTRTVSALHRRLDVPTGSTEG
EQSEMAHAIGGRREAG
NT seq
2751 nt
NT seq
+upstream
nt +downstream
nt
gtgcgcgcgcctctctcgaacccgatccgctcgctgtccgggcggctggccctggcggtg
gccagcgccgtcgccatcgccctgctcctcctgaccggtctgtcgacctggcgcgaggtc
gagcgctacgcggcggccaagcgggatcttcttcggatgacggcgcagatcctggccgcg
agcgccgcgcaggcgaccgcccggggcgacgaggcggcggcgcagagcaccctgcgggcg
atcgcccacggggaggccctggtctacgcgtcggtcgagcgggccgacggggacatcctc
gccgagcagggcatcggattgcgcctctcgaacgacatcgatctcgatcagggctccgtc
tcgccgctcgatctcgtgacgacgcggacactgcgcgtctcggttccgatcctggagaac
gcccgccccatcggccgcgtcgtcctggtctcggataaccgcgatttggccgagcgcgtc
acggaagtcggcctcacggcggggctcgccggattgctcgccctggcgctcgggcttgcc
gtctcgatgggtctgcagcgcagcgtcacccggccgctggcggcgctcgcccggaccatg
gatggagtgcgcctcggccacgactattcccggcgcgcggaggccggcagcggcgaggtc
ggcgcgctggccgagagcttcaacgacctcttgcgggccgtgaacgagcgcgaccgggcg
atcgcgcgctacaatgcgggcctggaagaagagatccggctgcggacccacgacctgatc
gaggccaagcaatcggccgacgaggccaacgcggccaagtccgtcttcctcgcaacgatg
agccacgagatccgcacgccgatgaacggcatgctggtgatggcggaactgctggcctcg
gccgacctgccgccgcgccagcagcgctacgccaaggtcatcgcccgctccggccaatcc
ctgctcgccatcatcaacgacatcctcgatttcgcgaaggtggaggccggccgcctcgag
gtggagcggatccccctgagcccgcgcgacgtcgccgacacggtcgtcaccctgtttgcc
gaacgcgcccggtcggcggggctcgacctcgcggcgcaaatcgacggcgacgtgccgcgc
tccctcctcggtgatcccgtgcgcctcgggcaggtgctcggcaacttcgtctcgaacgcg
ctcaagttcaccgccaccggccatgtcctggtgcggatggacatggagcgggacgcgtcc
ggtccggtcctgcgcctcgccgtgtccgacaccggcatcggcatcccgcaggaccggctg
tcggggatcttcaccgccttcacccaggccgaccagtcgatcgcgcgccgcttcggcggc
accgggctcgggctgtcgatcgccgagcgcctgatcgtcgccatgggcggccgcgtcggc
gtcgagagccgcctcggcgagggctcgacgttctgggcgcgcatccctgtcgagggcgcg
gagggcgccgagcccgccctccgccgcgcacccgctctgcccgccgctttccgcctcggc
gcgctcggcggtgcgacgcgcgccgcgctcacggccgatcttcaggccgcgggcttccat
cccgccgaatccggggagggtcactggatcgtcgaggcggcggagcttctggcgagcggt
cgccgcccggagggtgcgggccgggtcatcgccctggtgccgatcggcgacacctccggg
cccgaactcatgcgagcgggcctcgccgacgccgtgctgcgccggcccctcgcccaggcc
gagtggcgcccgctgctggccgccctcgccgaaggcacggccctcgccttcgaggccccg
gcagccgacgagagcgctgcttccgccctgccctcctttgccggcgcgcgggtgctgctc
gccgacgacagcgccgtcaaccgcgaggttgcggccgaagcgctcggccgcttcggcgtc
cacgacatcgtctgcgtcgaggatggtggggccgcggtggaggcggccgccgcgcatcgc
ttcgatctcgtcctgatggatggcagcatgccggtgctggacgggttcagcgccgccgtc
gccatccgcgcccgggaggcgcgggacggggcggaccgcgtgccgatcgtggccctgacc
gcgcatgtcgtcggcgacggcgccgaatcctggcaggcggcggggatggacggcatgctc
gccaagccgttcacgctggcgcagctcggcggcctgctggcgcagcatctgcaggccgcg
cccctccgcgacctggcggagatcgtgacgtcggaggcgccggcgccgcggatttcggac
gatgtgctgctcgacgagcagacgatcgccaatttggaagaactcggcgaccgcgacttc
ctcgcgcgcatcctccgcctctacatcgcccaggcgcctcgggcgctcctggagttcgaa
ggcgccctcgcccgcggcgatgccccggccgtgtcccgcgccgcgcacggcctcaagtcg
atgagcgccaatatcggcgcggtgcaggtgaaggatcgcgcgggcgccatcgagcgcacg
gcacgcgacggcgacctgacccgcctcgccgacgcggcgtccggcctggacggcctgctg
acccgcaccgtcagcgcgctccaccgccgtctcgacgtgcccaccgggagcaccgagggc
gaacagagcgagatggctcacgcgatcggcgggcggcgcgaagccggctga
DBGET
integrated database retrieval system