Methylobacterium sp. AMS5: Y590_24675
Help
Entry
Y590_24675 CDS
T04283
Name
(GenBank) benzoate transporter
KO
K24819
ATP-binding cassette, subfamily B, beta-glucan exporter [EC:
7.5.2.3
]
Organism
meta
Methylobacterium sp. AMS5
Brite
KEGG Orthology (KO) [BR:
meta00001
]
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
meta02000
]
Y590_24675
Enzymes [BR:
meta01000
]
7. Translocases
7.5 Catalysing the translocation of carbohydrates and their derivatives
7.5.2 Linked to the hydrolysis of a nucleoside triphosphate
7.5.2.3 ABC-type beta-glucan transporter
Y590_24675
Transporters [BR:
meta02000
]
ABC transporters, eukaryotic type
ABCB (MDR/TAP) subfamily
ABCB-BAC subgroup
Y590_24675
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
ABC_membrane
ABC_tran
SMC_N
AAA_16
AAA_22
Zeta_toxin
AAA_29
DUF87
SbcC_Walker_B
DUF6121
HUTI_composite_bact
AAA_18
ABC_ATPase
Motif
Other DBs
NCBI-ProteinID:
AMB48166
LinkDB
All DBs
Position
complement(5368084..5369856)
Genome browser
AA seq
590 aa
AA seq
DB search
MSMIRLYARVLGLLAAEKRLVGGLIAANVALAVAAFAEPLIMGRIIDGLTHLSKDAPATA
LAPWIVAWVVFGLFTIGAGVAIALHSDRLAHRNRLSTMANFFEHVLELPIAFHSSNHSGR
VLKAMLEGTNAMAWVWLNFFREHFSALLSVGVLLPLTLFVNWRLGAILVVLVLVFTALAS
YVMRRTETLQGEVEQFQSGLAAHASDALGNVAVIQSFTRARAEKEAMRTIIHDLLRVQIP
VLSWWALANVATRASGTLTMTAIFITGIALHQKGAATVGEIVAFMSLATMLVTKLDHVVT
FVNGVFMQAPKMREFFEVFDTVPTVRDRPHAKQVARFEGEVTFDDVAFSYDGRRSALDGV
TFAARPGETVALVGTTGSGKSTTLGLLHRTFDPDAGAIRIDGIDIRDIGLSSLRHNIGVV
FQEPMLFNRSIRENLQVGRPDATDAEMLDALDRAQASEFMARQPDGLDTIIGERGRSLSG
GERQRLSIARALLKNPPMLILDEATSALDAATERKLQQALETVMEGRTTFVIAHRLATIR
NADRILVFENGKIVEAGDFDELVALNQRFAALARAQFMAAEAEDDMPMAA
NT seq
1773 nt
NT seq
+upstream
nt +downstream
nt
atgtcgatgattcgcctctatgcgcgggtgctcggcctattggcagcggaaaagcgtctg
gtcggcggcctgatcgcggccaacgtcgcgctcgcggtcgcggccttcgccgaaccgctc
atcatgggccgcatcatcgacggcctgactcacctctccaaggacgcgcccgcgaccgcg
ctggcgccgtggatcgtcgcatgggtcgtgttcggcctgttcaccatcggtgcgggggtc
gcgatcgctctgcattccgaccggctcgcccatcgcaaccgcctctcgaccatggcgaac
ttcttcgagcacgtgctcgaactgccgatcgccttccattcgtccaaccattccggccgc
gtgctgaaggcgatgctggaaggcacgaacgccatggcctgggtctggctcaacttcttc
cgcgagcacttctccgcgctgctctccgtcggcgtgctcctgccgctgacgctgttcgtg
aactggcgtctcggcgcgatcctcgtcgtgctcgtcctcgtcttcacggcgctggcgagc
tacgtcatgcgccggaccgagacgcttcagggcgaggtcgagcagttccagtcgggactg
gcggcccacgcttccgacgcgctcggcaacgtcgcggtgattcagtccttcacccgtgcg
cgcgccgagaaggaggcgatgcgcaccatcatccacgacctgctccgcgtgcagattccg
gtcctgtcgtggtgggcgctggcgaacgtcgctacccgcgcctccggcacgctgaccatg
accgcgatcttcatcaccggcatcgccctgcaccagaagggtgcggccacggtcggcgag
atcgtcgccttcatgagcctcgccaccatgctcgtgaccaagctcgaccacgtcgtgacc
ttcgtgaacggcgtgttcatgcaggctccgaagatgcgcgagttcttcgaggtgttcgac
accgtgccgaccgtccgcgaccggccgcatgccaagcaggtcgcccggttcgagggcgag
gtgaccttcgacgacgtcgccttctcctacgacggccgccgcagcgcgctcgacggcgtt
accttcgccgcccgccccggcgagaccgtggcgctcgtcggcaccacgggttcgggcaag
tccacgacgctgggcctgctgcaccggaccttcgatcccgatgcaggcgccatccgcatc
gacgggatcgatatccgcgacatcggcctgtcgagcctgcgccacaacatcggcgtcgtc
ttccaggagccgatgctgttcaaccgctcgatccgcgagaacctccaggtcggccgcccc
gacgcgaccgatgccgagatgcttgatgccctcgatcgcgctcaagccagcgagttcatg
gcgcgccagccggatggactcgacacgatcatcggcgagcgcggccggtcgctgtccggt
ggcgagcgccagcgcctctcgatcgcgcgggcactgctgaagaacccgccgatgctgatc
ctcgacgaggcgaccagtgctctcgacgcggcgaccgagcgcaagctgcagcaggcgctg
gagacggtgatggagggccgcaccaccttcgtgatcgcccaccgcctcgccacgatccgc
aacgccgaccgcatcctcgtgttcgagaacggcaagatcgtcgaggccggcgatttcgac
gaactggtcgctctcaaccagcgcttcgccgcgctcgcccgggctcagttcatggcggcc
gaggccgaggacgacatgccgatggccgcctga
DBGET
integrated database retrieval system